PDB entry 3tte

View 3tte on RCSB PDB site
Description: Crystal structure of enolase brado_4202 (target EFI-501651) from Bradyrhizobium complexed with magnesium and mandelic acid
Class: lyase
Keywords: enolase, magnesium binding site, lyase
Deposited on 2011-09-14, released 2011-09-28
The last revision prior to the SCOPe 2.06 freeze date was dated 2012-02-22, with a file datestamp of 2012-02-17.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.206
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Mandelate racemase/muconate lactonizing enzyme
    Species: Bradyrhizobium sp. ORS 278 [TaxId:114615]
    Gene: BRADO4202
    Database cross-references and differences (RAF-indexed):
    • Uniprot A4YVM8 (23-382)
      • expression tag (22)
    Domains in SCOPe 2.06: d3ttea1, d3ttea2, d3ttea3
  • Chain 'B':
    Compound: Mandelate racemase/muconate lactonizing enzyme
    Species: Bradyrhizobium sp. ORS 278 [TaxId:114615]
    Gene: BRADO4202
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3tteb1, d3tteb2
  • Heterogens: MG, SMN, GOL, FMT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3tteA (A:)
    mhhhhhhssgvdlgtenlyfqsmmttaaitgvtaravitpmkrplrnafgvidsgplvli
    dvttdqgvtghsylfaytrlalkplvhlvedigrelagkalvpvdlmkamdakfrllgwq
    glvgmavsgldmafwdalgqlagkpvvellggsarpipaydsygvldarddertlrtacd
    ehgfraikskgghgdlatdeamikglrallgpdialmldfnqsldpaeatrriarladyd
    ltwieepvpqenlsghaavrerseipiqagenwwfprgfaeaiaagasdfimpdlmkvgg
    itgwlnvagqadaasipmsshilpeasahvlpvtptahflevldfagailteplrvidgk
    vtakgpglglawnesavakyqvt
    

    Sequence, based on observed residues (ATOM records): (download)
    >3tteA (A:)
    mmttaaitgvtaravitpmkrplrnafgvidsgplvlidvttdqgvtghsylfaytrlal
    kplvhlvedigrelagkalvpvdlmkamdakfrllgwqglvgmavsgldmafwdalgqla
    gkpvvellggsarpipaydsygvldarddertlrtacdehgfraikskgghgdlatdeam
    ikglrallgpdialmldfnqsldpaeatrriarladydltwieepvpqenlsghaavrer
    seipiqagenwwfprgfaeaiaagasdfimpdlmkvggitgwlnvagqadaasipmsshi
    lpeasahvlpvtptahflevldfagailteplrvidgkvtakgpglglawnesavakyqv
    t
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3tteB (B:)
    mhhhhhhssgvdlgtenlyfqsmmttaaitgvtaravitpmkrplrnafgvidsgplvli
    dvttdqgvtghsylfaytrlalkplvhlvedigrelagkalvpvdlmkamdakfrllgwq
    glvgmavsgldmafwdalgqlagkpvvellggsarpipaydsygvldarddertlrtacd
    ehgfraikskgghgdlatdeamikglrallgpdialmldfnqsldpaeatrriarladyd
    ltwieepvpqenlsghaavrerseipiqagenwwfprgfaeaiaagasdfimpdlmkvgg
    itgwlnvagqadaasipmsshilpeasahvlpvtptahflevldfagailteplrvidgk
    vtakgpglglawnesavakyqvt
    

    Sequence, based on observed residues (ATOM records): (download)
    >3tteB (B:)
    ttaaitgvtaravitpmkrplrnafgvidsgplvlidvttdqgvtghsylfaytrlalkp
    lvhlvedigrelagkalvpvdlmkamdakfrllgwqglvgmavsgldmafwdalgqlagk
    pvvellggsarpipaydsygvldarddertlrtacdehgfraikskgghgdlatdeamik
    glrallgpdialmldfnqsldpaeatrriarladydltwieepvpqenlsghaavrerse
    ipiqagenwwfprgfaeaiaagasdfimpdlmkvggitgwlnvagqadaasipmsshilp
    easahvlpvtptahflevldfagailteplrvidgkvtakgpglglawnesavakyqvt