PDB entry 3tt1

View 3tt1 on RCSB PDB site
Description: Crystal Structure of LeuT in the outward-open conformation in complex with Fab
Class: transport protein
Keywords: LeuT fold, transporter, plasma membrane, TRANSPORT PROTEIN
Deposited on 2011-09-13, released 2012-01-04
The last revision prior to the SCOPe 2.06 freeze date was dated 2012-02-01, with a file datestamp of 2012-01-27.
Experiment type: XRAY
Resolution: 3.1 Å
R-factor: 0.22
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Leucine transporter LeuT
    Species: Aquifex aeolicus [TaxId:63363]
    Gene: snf, aq_2077
    Database cross-references and differences (RAF-indexed):
    • Uniprot O67854
      • engineered mutation (107)
      • engineered mutation (287)
    Domains in SCOPe 2.06: d3tt1a_
  • Chain 'B':
    Compound: Leucine transporter LeuT
    Species: Aquifex aeolicus [TaxId:63363]
    Gene: snf, aq_2077
    Database cross-references and differences (RAF-indexed):
    • Uniprot O67854
      • engineered mutation (107)
      • engineered mutation (287)
    Domains in SCOPe 2.06: d3tt1b_
  • Chain 'H':
    Compound: mouse monoclonal 1gG2a Fab fragment, kappa light chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 3TT1 (0-218)
  • Chain 'I':
    Compound: mouse monoclonal 1gG2a Fab fragment, kappa light chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 3TT1 (0-218)
  • Chain 'L':
    Compound: mouse monoclonal 1gG2a Fab fragment, heavy chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 3TT1 (0-End)
    Domains in SCOPe 2.06: d3tt1l1, d3tt1l2
  • Chain 'M':
    Compound: mouse monoclonal 1gG2a Fab fragment, heavy chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 3TT1 (0-End)
    Domains in SCOPe 2.06: d3tt1m1, d3tt1m2
  • Heterogens: NA, SOG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3tt1A (A:)
    mevkrehwatrlglilamagnavglgnflrfpvqaaengggafmipyiiafllvgiplmw
    iewamgryggaqghgttpaifyllwrnrfakilgvfglwiplvvaiyfvyieswtlgfai
    kflvglvpepppnatdpdsilrpfkeflysyigvpkgdepilkpslfayivflitmfinv
    silirgiskgierfakiamptlfilavflvirvflletpngtaadglnflwtpdfeklkd
    pgvwiaavgqifftlslgfgaiityasyvrkdqdivlsgltaatlneaaevilggsisip
    aavaffgvanavaiakagafnlgfitlpaifsqtaggtflgflwffllffagltssiaim
    qpmiafledelklsrkhavlwtaaivffsahlvmflnksldemdfwagtigvvffgltel
    iiffwifgadkaweeinrggiikvpriyyyvmryitpaflavllvvwareyipkimeeth
    wtvwitrfyiiglflfltflvflaerrrnhesagtlvpr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3tt1A (A:)
    rehwatrlglilamagnavglgnflrfpvqaaengggafmipyiiafllvgiplmwiewa
    mgryggaqghgttpaifyllwrnrfakilgvfglwiplvvaiyfvyieswtlgfaikflv
    glvpetdpdsilrpfkeflysyigvpkgdepilkpslfayivflitmfinvsilirgisk
    gierfakiamptlfilavflvirvflletpngtaadglnflwtpdfeklkdpgvwiaavg
    qifftlslgfgaiityasyvrkdqdivlsgltaatlneaaevilggsisipaavaffgva
    navaiakagafnlgfitlpaifsqtaggtflgflwffllffagltssiaimqpmiafled
    elklsrkhavlwtaaivffsahlvmflnksldemdfwagtigvvffglteliiffwifga
    dkaweeinrggiikvpriyyyvmryitpaflavllvvwareyipkimeethwtvwitrfy
    iiglflfltflvflaerr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3tt1B (B:)
    mevkrehwatrlglilamagnavglgnflrfpvqaaengggafmipyiiafllvgiplmw
    iewamgryggaqghgttpaifyllwrnrfakilgvfglwiplvvaiyfvyieswtlgfai
    kflvglvpepppnatdpdsilrpfkeflysyigvpkgdepilkpslfayivflitmfinv
    silirgiskgierfakiamptlfilavflvirvflletpngtaadglnflwtpdfeklkd
    pgvwiaavgqifftlslgfgaiityasyvrkdqdivlsgltaatlneaaevilggsisip
    aavaffgvanavaiakagafnlgfitlpaifsqtaggtflgflwffllffagltssiaim
    qpmiafledelklsrkhavlwtaaivffsahlvmflnksldemdfwagtigvvffgltel
    iiffwifgadkaweeinrggiikvpriyyyvmryitpaflavllvvwareyipkimeeth
    wtvwitrfyiiglflfltflvflaerrrnhesagtlvpr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3tt1B (B:)
    rehwatrlglilamagnavglgnflrfpvqaaengggafmipyiiafllvgiplmwiewa
    mgryggaqghgttpaifyllwrnrfakilgvfglwiplvvaiyfvyieswtlgfaikflv
    glvpetdpdsilrpfkeflysyigvpkgdepilkpslfayivflitmfinvsilirgisk
    gierfakiamptlfilavflvirvflletpngtaadglnflwtpdfeklkdpgvwiaavg
    qifftlslgfgaiityasyvrkdqdivlsgltaatlneaaevilggsisipaavaffgva
    navaiakagafnlgfitlpaifsqtaggtflgflwffllffagltssiaimqpmiafled
    elklsrkhavlwtaaivffsahlvmflnksldemdfwagtigvvffglteliiffwifga
    dkaweeinrggiikvpriyyyvmryitpaflavllvvwareyipkimeethwtvwitrfy
    iiglflfltflvflaerr
    

  • Chain 'H':
    No sequence available.

  • Chain 'I':
    No sequence available.

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >3tt1L (L:)
    divltqspaslavslgqratisckasqsvdydgdsymnwyqqkpgqppklliygasnles
    giparfsgsgsgtdftlnihpveeedaatyycqqsnedpytfgggtkleikradaaptvs
    ifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysms
    stltltkdeyerhnsytceathktstspivksfnrnec
    

    Sequence, based on observed residues (ATOM records): (download)
    >3tt1L (L:)
    divltqspaslavslgqratisckasqsvdydgdsymnwyqqkpgqppklliygasnles
    giparfsgsgsgtdftlnihpveeedaatyycqqsnedpytfgggtkleikradaaptvs
    ifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysms
    stltltkdeyerhnsytceathktstspivksfnr
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >3tt1M (M:)
    divltqspaslavslgqratisckasqsvdydgdsymnwyqqkpgqppklliygasnles
    giparfsgsgsgtdftlnihpveeedaatyycqqsnedpytfgggtkleikradaaptvs
    ifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysms
    stltltkdeyerhnsytceathktstspivksfnrnec
    

    Sequence, based on observed residues (ATOM records): (download)
    >3tt1M (M:)
    divltqspaslavslgqratisckasqsvdydgdsymnwyqqkpgqppklliygasnles
    giparfsgsgsgtdftlnihpveeedaatyycqqsnedpytfgggtkleikradaaptvs
    ifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysms
    stltltkdeyerhnsytceathktstspivksfnr