PDB entry 3tt0

View 3tt0 on RCSB PDB site
Description: Co-structure of Fibroblast Growth Factor Receptor 1 kinase domain with 3-(2,6-dichloro-3,5-dimethoxy-phenyl)-1-{6-[4-(4-ethyl-piperazin-1-yl)-phenylamino]-pyrimidin-4-yl}-1-methyl-urea (BGJ398)
Class: transferase/transferase inhibitor
Keywords: kinase domain, TRANSFERASE, TRANSFERASE-TRANSFERASE INHIBITOR complex
Deposited on 2011-09-13, released 2012-06-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-06-13, with a file datestamp of 2012-06-08.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.207
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Basic fibroblast growth factor receptor 1
    Species: Homo sapiens [TaxId:9606]
    Gene: FGFR1, FGFBR, FLG, FLT2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P11362 (Start-357)
      • conflict (80)
      • engineered mutation (176)
    Domains in SCOPe 2.07: d3tt0a_
  • Chain 'B':
    Compound: Basic fibroblast growth factor receptor 1
    Species: Homo sapiens [TaxId:9606]
    Gene: FGFR1, FGFBR, FLG, FLT2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P11362
      • conflict (80)
    Domains in SCOPe 2.07: d3tt0b_
  • Heterogens: 07J, SO4, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3tt0A (A:)
    mgyyhhhhhhdydipttenlyfngmgyyhhhhhhdydipttenlyfqgmlagvseyelpe
    dprwelprdrlvlgkplgegafgqvvlaeaigldkdkpnrvtkvavkmlksdatekdlsd
    lisememmkmigkhkniinllgactqdgplyviveyaskgnlreylqarrppgleysynp
    shnpeeqlsskdlvscayqvargmeylaskkcihrdlaarnvlvtednvmkiadfglard
    ihhidyykkttngrlpvkwmapealfdriythqsdvwsfgvllweiftlggspypgvpve
    elfkllkeghrmdkpsnctnelymmmrdcwhavpsqrptfkqlvedldrivaltsnqemg
    yyhhhhhhdydipttenlyfng
    

    Sequence, based on observed residues (ATOM records): (download)
    >3tt0A (A:)
    seyelpedprwelprdrlvlgkplgegafgqvvlaeaigldkdkpnrvtkvavkmlksda
    tekdlsdlisememmkmigkhkniinllgactqdgplyviveyaskgnlreylqarrppg
    leysynpshnpeeqlsskdlvscayqvargmeylaskkcihrdlaarnvlvtednvmkia
    dfglardihhidyykkttngrlpvkwmapealfdriythqsdvwsfgvllweiftlggsp
    ypgvpveelfkllkeghrmdkpsnctnelymmmrdcwhavpsqrptfkqlvedldrival
    tsnqe
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3tt0B (B:)
    mgyyhhhhhhdydipttenlyfngmgyyhhhhhhdydipttenlyfqgmlagvseyelpe
    dprwelprdrlvlgkplgegafgqvvlaeaigldkdkpnrvtkvavkmlksdatekdlsd
    lisememmkmigkhkniinllgactqdgplyviveyaskgnlreylqarrppgleysynp
    shnpeeqlsskdlvscayqvargmeylaskkcihrdlaarnvlvtednvmkiadfglard
    ihhidyykkttngrlpvkwmapealfdriythqsdvwsfgvllweiftlggspypgvpve
    elfkllkeghrmdkpsnctnelymmmrdcwhavpsqrptfkqlvedldrivaltsnqemg
    yyhhhhhhdydipttenlyfng
    

    Sequence, based on observed residues (ATOM records): (download)
    >3tt0B (B:)
    gvseyelpedprwelprdrlvlgkplgegafgqvvlaeaigldkdkpnrvtkvavkmlks
    datekdlsdlisememmkmigkhkniinllgactqdgplyviveyaskgnlreylqarrq
    lsskdlvscayqvargmeylaskkcihrdlaarnvlvtednvmkiadfglapvkwmapea
    lfdriythqsdvwsfgvllweiftlggspypgvpveelfkllkeghrmdkpsnctnelym
    mmrdcwhavpsqrptfkqlvedldrivaltsn