PDB entry 3tsr

View 3tsr on RCSB PDB site
Description: X-ray structure of mouse ribonuclease inhibitor complexed with mouse ribonuclease 1
Class: hydrolase/hydrolase inhibitor
Keywords: hydrolase, hydrolase inhibitor, leucine-rich repeat, HYDROLASE-HYDROLASE INHIBITOR complex
Deposited on 2011-09-13, released 2012-09-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: N/A
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ribonuclease pancreatic
    Species: Mus musculus [TaxId:10090]
    Gene: Rib-1, Rib1, Rnase1, Rns1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3tsra_
  • Chain 'B':
    Compound: ribonuclease pancreatic
    Species: Mus musculus [TaxId:10090]
    Gene: Rib-1, Rib1, Rnase1, Rns1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3tsrb_
  • Chain 'C':
    Compound: ribonuclease pancreatic
    Species: Mus musculus [TaxId:10090]
    Gene: Rib-1, Rib1, Rnase1, Rns1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3tsrc_
  • Chain 'D':
    Compound: ribonuclease pancreatic
    Species: Mus musculus [TaxId:10090]
    Gene: Rib-1, Rib1, Rnase1, Rns1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3tsrd_
  • Chain 'E':
    Compound: ribonuclease inhibitor
    Species: Mus musculus [TaxId:10090]
    Gene: Rnh, Rnh1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q91VI7 (1-456)
      • expression tag (0)
    Domains in SCOPe 2.07: d3tsre1, d3tsre2
  • Chain 'F':
    Compound: ribonuclease inhibitor
    Species: Mus musculus [TaxId:10090]
    Gene: Rnh, Rnh1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q91VI7 (1-456)
      • expression tag (0)
    Domains in SCOPe 2.07: d3tsrf1, d3tsrf2
  • Chain 'G':
    Compound: ribonuclease inhibitor
    Species: Mus musculus [TaxId:10090]
    Gene: Rnh, Rnh1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q91VI7 (1-456)
      • expression tag (0)
    Domains in SCOPe 2.07: d3tsrg1, d3tsrg2
  • Chain 'H':
    Compound: ribonuclease inhibitor
    Species: Mus musculus [TaxId:10090]
    Gene: Rnh, Rnh1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q91VI7 (1-456)
      • expression tag (0)
    Domains in SCOPe 2.07: d3tsrh1, d3tsrh2
  • Heterogens: EDO, PEG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3tsrA (A:)
    mresaaqkfqrqhmdpdgssinsptycnqmmkrrdmtngsckpvntfvhepladvqavcs
    qenvtcknrksncyksssalhitdchlkgnskypncdykttqyqkhiivacegnpyvpvh
    fdatv
    

    Sequence, based on observed residues (ATOM records): (download)
    >3tsrA (A:)
    resaaqkfqrqhmdpdgssinsptycnqmmkrrdmtngsckpvntfvhepladvqavcsq
    envtcknrksncyksssalhitdchlkgnskypncdykttqyqkhiivacegnpyvpvhf
    datv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3tsrB (B:)
    mresaaqkfqrqhmdpdgssinsptycnqmmkrrdmtngsckpvntfvhepladvqavcs
    qenvtcknrksncyksssalhitdchlkgnskypncdykttqyqkhiivacegnpyvpvh
    fdatv
    

    Sequence, based on observed residues (ATOM records): (download)
    >3tsrB (B:)
    esaaqkfqrqhmdpdgssinsptycnqmmkrrdmtngsckpvntfvhepladvqavcsqe
    nvtcknrksncyksssalhitdchlkgnskypncdykttqyqkhiivacegnpyvpvhfd
    atv
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3tsrC (C:)
    mresaaqkfqrqhmdpdgssinsptycnqmmkrrdmtngsckpvntfvhepladvqavcs
    qenvtcknrksncyksssalhitdchlkgnskypncdykttqyqkhiivacegnpyvpvh
    fdatv
    

    Sequence, based on observed residues (ATOM records): (download)
    >3tsrC (C:)
    esaaqkfqrqhmdpsptycnqmmkrrdmtngsckpvntfvhepladvqavcsqenvtckn
    rksncyksssalhitdchlkgnskypncdykttqyqkhiivacegnpyvpvhfdatv
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3tsrD (D:)
    mresaaqkfqrqhmdpdgssinsptycnqmmkrrdmtngsckpvntfvhepladvqavcs
    qenvtcknrksncyksssalhitdchlkgnskypncdykttqyqkhiivacegnpyvpvh
    fdatv
    

    Sequence, based on observed residues (ATOM records): (download)
    >3tsrD (D:)
    esaaqkfqrqhmptycnqmmkrrdmtngsckpvntfvhepladvqavcsqenvtcknrks
    ncyksssalhitdchlkgnskypncdykttqyqkhiivacegnpyvpvhfdat
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3tsrE (E:)
    mmsldiqceqlsdarwtellpliqqyevvrlddcgltevrckdissavqanpaltelslr
    tnelgdggvglvlqglqnptckiqklslqncglteagcgilpgmlrslstlrelhlndnp
    mgdaglkllceglqdpqcrleklqleycnltatsceplasvlrvkadfkelvlsnndlhe
    pgvrilcqglkdsacqleslklencgitaanckdlcdvvaskaslqeldlssnklgnagi
    aalcpglllpscklrtlwlwecditaegckdlcrvlrakqslkelslasnelkdegarll
    cesllepgcqleslwiktcsltaascpyfcsvltksrsllelqmssnplgdegvqelcka
    lsqpdtvlrelwlgdcdvtnsgcsslanvllanrslreldlsnncmggpgvlqlleslkq
    psctlqqlvlydiywtneveeqlraleeerpslriis
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3tsrF (F:)
    mmsldiqceqlsdarwtellpliqqyevvrlddcgltevrckdissavqanpaltelslr
    tnelgdggvglvlqglqnptckiqklslqncglteagcgilpgmlrslstlrelhlndnp
    mgdaglkllceglqdpqcrleklqleycnltatsceplasvlrvkadfkelvlsnndlhe
    pgvrilcqglkdsacqleslklencgitaanckdlcdvvaskaslqeldlssnklgnagi
    aalcpglllpscklrtlwlwecditaegckdlcrvlrakqslkelslasnelkdegarll
    cesllepgcqleslwiktcsltaascpyfcsvltksrsllelqmssnplgdegvqelcka
    lsqpdtvlrelwlgdcdvtnsgcsslanvllanrslreldlsnncmggpgvlqlleslkq
    psctlqqlvlydiywtneveeqlraleeerpslriis
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3tsrG (G:)
    mmsldiqceqlsdarwtellpliqqyevvrlddcgltevrckdissavqanpaltelslr
    tnelgdggvglvlqglqnptckiqklslqncglteagcgilpgmlrslstlrelhlndnp
    mgdaglkllceglqdpqcrleklqleycnltatsceplasvlrvkadfkelvlsnndlhe
    pgvrilcqglkdsacqleslklencgitaanckdlcdvvaskaslqeldlssnklgnagi
    aalcpglllpscklrtlwlwecditaegckdlcrvlrakqslkelslasnelkdegarll
    cesllepgcqleslwiktcsltaascpyfcsvltksrsllelqmssnplgdegvqelcka
    lsqpdtvlrelwlgdcdvtnsgcsslanvllanrslreldlsnncmggpgvlqlleslkq
    psctlqqlvlydiywtneveeqlraleeerpslriis
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3tsrH (H:)
    mmsldiqceqlsdarwtellpliqqyevvrlddcgltevrckdissavqanpaltelslr
    tnelgdggvglvlqglqnptckiqklslqncglteagcgilpgmlrslstlrelhlndnp
    mgdaglkllceglqdpqcrleklqleycnltatsceplasvlrvkadfkelvlsnndlhe
    pgvrilcqglkdsacqleslklencgitaanckdlcdvvaskaslqeldlssnklgnagi
    aalcpglllpscklrtlwlwecditaegckdlcrvlrakqslkelslasnelkdegarll
    cesllepgcqleslwiktcsltaascpyfcsvltksrsllelqmssnplgdegvqelcka
    lsqpdtvlrelwlgdcdvtnsgcsslanvllanrslreldlsnncmggpgvlqlleslkq
    psctlqqlvlydiywtneveeqlraleeerpslriis