PDB entry 3tso

View 3tso on RCSB PDB site
Description: Structure of the cancer associated Rab25 protein in complex with FIP2
Class: protein transport
Keywords: Ras GTPase fold (Rab25), vesicle trafficking, endosome, PROTEIN TRANSPORT
Deposited on 2011-09-13, released 2012-09-19
The last revision prior to the SCOPe 2.04 freeze date was dated 2012-09-19, with a file datestamp of 2012-09-14.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.201
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ras-related protein Rab-25
    Species: Homo sapiens [TaxId:9606]
    Gene: RAB25, CATX8
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3tsoa_
  • Chain 'B':
    Compound: Ras-related protein Rab-25
    Species: Homo sapiens [TaxId:9606]
    Gene: RAB25, CATX8
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3tsob_
  • Chain 'C':
    Compound: Rab11 family-interacting protein 2
    Species: Homo sapiens [TaxId:9606]
    Gene: RAB11FIP2, KIAA0941
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: Rab11 family-interacting protein 2
    Species: Homo sapiens [TaxId:9606]
    Gene: RAB11FIP2, KIAA0941
    Database cross-references and differences (RAF-indexed):
  • Heterogens: MG, GNP, GOL, PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3tsoA (A:)
    gshmedynfvfkvvligesgvgktnllsrftrnefshdsrttigvefstrtvmlgtaavk
    aqiwdtagleryraitsayyrgavgallvfdltkhqtyavverwlkelydhaeativvml
    vgnksdlsqarevpteearmfaenngllfletsaldstnvelafetvlkeifakvskq
    

    Sequence, based on observed residues (ATOM records): (download)
    >3tsoA (A:)
    nfvfkvvligesgvgktnllsrftrnefshdsrttigvefstrtvmlgtaavkaqiwdta
    gleryraitsayyrgavgallvfdltkhqtyavverwlkelydhaeativvmlvgnksdl
    sqarevpteearmfaenngllfletsaldstnvelafetvlkeifakvs
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3tsoB (B:)
    gshmedynfvfkvvligesgvgktnllsrftrnefshdsrttigvefstrtvmlgtaavk
    aqiwdtagleryraitsayyrgavgallvfdltkhqtyavverwlkelydhaeativvml
    vgnksdlsqarevpteearmfaenngllfletsaldstnvelafetvlkeifakvskq
    

    Sequence, based on observed residues (ATOM records): (download)
    >3tsoB (B:)
    fvfkvvligesgvgktnllsrftrnefshdsrttigvefstrtvmlgtaavkaqiwdtag
    leryraitsayyrgavgallvfdltkhqtyavverwlkelydhaeativvmlvgnksdls
    qarevpteearmfaenngllfletsaldstnvelafetvlkeifakv
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.