PDB entry 3ts7

View 3ts7 on RCSB PDB site
Description: CRYSTAL STRUCTURE OF FARNESYL DIPHOSPHATE SYNTHASE (TARGET EFI-501951) FROM Methylococcus capsulatus
Class: transferase
Keywords: isoprenoid synthesis, farnesyl diphosphate synthase, transferase
Deposited on 2011-09-12, released 2011-10-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-04-10, with a file datestamp of 2013-04-05.
Experiment type: XRAY
Resolution: 1.94 Å
R-factor: 0.221
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Geranyltranstransferase
    Species: Methylococcus capsulatus [TaxId:414]
    Gene: ispA, MCA0818
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q60AN0 (Start-301)
      • expression tag (302-308)
    Domains in SCOPe 2.07: d3ts7a1, d3ts7a2
  • Chain 'B':
    Compound: Geranyltranstransferase
    Species: Methylococcus capsulatus [TaxId:414]
    Gene: ispA, MCA0818
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q60AN0 (Start-301)
      • expression tag (302-310)
    Domains in SCOPe 2.07: d3ts7b1, d3ts7b2
  • Heterogens: PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3ts7A (A:)
    mvmnperslsdfmrssqerveraldarlpaadrmperlhqamrysvlgggkrmrplltya
    tgqtigvaadlldgpacavefihvyslihddlpamddddlrrgkptchkaydeatailag
    dglqalafhvlaqdpsiavpaenriamietlakasgpagmvggqaidlasvgkkldlpgl
    enmhirktgalirasvrlaclarpglpaeqfdrldhyakciglafqiqddildeesdtqt
    lgktrgkdrdhnkpnypallglsgakekaeemheaaleslagfgpeadllrelarfiiqr
    qsaenlyfqshhhhhhwshpqfek
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ts7A (A:)
    erslsdfmrssqerveraldarlpaadrmperlhqamrysvlgggkrmrplltyatgqti
    gvaadlldgpacavefihvyslihddlpamddddlrrgkptchkaydeatailagdglqa
    lafhvlaqdpsiavpaenriamietlakasgpagmvggqaidlasvgkkldlpglenmhi
    rktgalirasvrlaclarpglpaeqfdrldhyakciglafqiqddildeesdkpnypall
    glsgakekaeemheaaleslagfgpeadllrelarfiiqrqsaenlyfq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3ts7B (B:)
    mvmnperslsdfmrssqerveraldarlpaadrmperlhqamrysvlgggkrmrplltya
    tgqtigvaadlldgpacavefihvyslihddlpamddddlrrgkptchkaydeatailag
    dglqalafhvlaqdpsiavpaenriamietlakasgpagmvggqaidlasvgkkldlpgl
    enmhirktgalirasvrlaclarpglpaeqfdrldhyakciglafqiqddildeesdtqt
    lgktrgkdrdhnkpnypallglsgakekaeemheaaleslagfgpeadllrelarfiiqr
    qsaenlyfqshhhhhhwshpqfek
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ts7B (B:)
    nperslsdfmrssqerveraldarlpaadrmperlhqamrysvlgggkrmrplltyatgq
    tigvaadlldgpacavefihvyslihddlpamddddlrrgkptchkaydeatailagdgl
    qalafhvlaqdpsiavpaenriamietlakasgpagmvggqaidlasvgkkldlpglenm
    hirktgalirasvrlaclarpglpaeqfdrldhyakciglafqiqddildeesdtqtlkp
    nypallglsgakekaeemheaaleslagfgpeadllrelarfiiqrqsaenlyfqsh