PDB entry 3trx

View 3trx on RCSB PDB site
Description: high-resolution three-dimensional structure of reduced recombinant human thioredoxin in solution
Deposited on 1990-12-17, released 1992-01-15
The last revision prior to the SCOP 1.65 freeze date was dated 1993-01-15, with a file datestamp of 1994-01-31.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.07 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.65: d3trx__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3trx_ (-)
    mvkqiesktafqealdaagdklvvvdfsatwcgpckmikpffhslsekysnviflevdvd
    dcqdvasecevkctptfqffkkgqkvgefsgankekleatinelv