PDB entry 3tr7

View 3tr7 on RCSB PDB site
Description: Structure of a uracil-DNA glycosylase (ung) from Coxiella burnetii
Class: hydrolase
Keywords: DNA metabolism, HYDROLASE
Deposited on 2011-09-09, released 2011-09-21
The last revision prior to the SCOPe 2.02 freeze date was dated 2011-09-21, with a file datestamp of 2011-09-16.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.191
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: uracil-DNA glycosylase
    Species: Coxiella burnetii [TaxId:777]
    Gene: CBU_0988, ung
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d3tr7a_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3tr7A (A:)
    snamttmaetqtwqtvlgeekqepyfqeildfvkkerkagkiiyppqkdifnalkltpye
    aikvvilgqdpyhgpnqahglafsvrpgvpappslqnifkelhadlgvsipshgflekwa
    kqgvlllnaaltveagkpqshanigwhrftdkvieslndhpegivfllwgsyaqkksqli
    tnlrhrilkaphpsplsaargflgcrhfskanqllhemgrgeidwaldekvs
    

    Sequence, based on observed residues (ATOM records): (download)
    >3tr7A (A:)
    tqtwqtvlgeekqepyfqeildfvkkerkagkiiyppqkdifnalkltpyeaikvvilgq
    dpyhgpnqahglafsvrpgvpappslqnifkelhadlgvsipshgflekwakqgvlllna
    altveagkpqshanigwhrftdkvieslndhpegivfllwgsyaqkksqlitnlrhrilk
    aphpsplsaargflgcrhfskanqllhemgrgeidwald