PDB entry 3tqt

View 3tqt on RCSB PDB site
Description: Structure of the D-alanine-D-alanine ligase from Coxiella burnetii
Class: ligase
Keywords: Cell envelope, LIGASE
Deposited on 2011-09-09, released 2011-09-28
The last revision prior to the SCOPe 2.03 freeze date was dated 2011-09-28, with a file datestamp of 2011-09-23.
Experiment type: XRAY
Resolution: 1.88 Å
R-factor: 0.183
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: d-alanine--d-alanine ligase
    Species: Coxiella burnetii [TaxId:227377]
    Gene: ddl, CBU_1338
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3tqta1, d3tqta2
  • Chain 'B':
    Compound: d-alanine--d-alanine ligase
    Species: Coxiella burnetii [TaxId:227377]
    Gene: ddl, CBU_1338
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3tqtb1, d3tqtb2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3tqtA (A:)
    maeklhisvlcggqsteheisiqsaknivntldaakylisvifidhvgrwylidqpemfl
    ahspdhlvkegsarpitiafgdaakpwqslngdgrrysadcvfpmvhgtqgedgalqgll
    ellnlpyvganvqssavcmekdltktvlraggipvvdwhtlsprdategvyqrlldrwgt
    selfvkavslgssvatlpvkteteftkavkevfryddrlmveprirgreiecavlgngap
    kaslpgeiiphhdyysydakyldpngattttsvdlsesvtkqiqqiaidafkmvhcsgma
    rvdffvtpnnkvlvneintipgftnismypkmweasglpcpnlldqlielaidrhqeqqk
    lircyevkarsl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3tqtA (A:)
    aeklhisvlcggqsteheisiqsaknivntldaakylisvifidhvgrwylidqpemfla
    hspdhlvkegsarpitiafgdaakpwqslrrysadcvfpmvhgtqgedgalqgllellnl
    pyvganvqssavcmekdltktvlraggipvvdwhtlsprdategvyqrlldrwelfvkav
    slgssvatlpvkteteftkavkevfryddrlmveprirgreiecavlgngapkaslpgei
    iphattttsvdlsesvtkqiqqiaidafkmvhcsgmarvdffvtpnnkvlvneintipgf
    tnismypkmweasglpcpnlldqlielaidrhqeqqklircyevkars
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3tqtB (B:)
    maeklhisvlcggqsteheisiqsaknivntldaakylisvifidhvgrwylidqpemfl
    ahspdhlvkegsarpitiafgdaakpwqslngdgrrysadcvfpmvhgtqgedgalqgll
    ellnlpyvganvqssavcmekdltktvlraggipvvdwhtlsprdategvyqrlldrwgt
    selfvkavslgssvatlpvkteteftkavkevfryddrlmveprirgreiecavlgngap
    kaslpgeiiphhdyysydakyldpngattttsvdlsesvtkqiqqiaidafkmvhcsgma
    rvdffvtpnnkvlvneintipgftnismypkmweasglpcpnlldqlielaidrhqeqqk
    lircyevkarsl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3tqtB (B:)
    klhisvlcggqsteheisiqsaknivntldaakylisvifidhvgrwylidqpemflahs
    pdhlvkegsarpitiafkpwqsldgrrysadcvfpmvhgtqgedgalqgllellnlpyvg
    anvqssavcmekdltktvlraggipvvdwhtlsprdategvyqrlldrwgtselfvkavs
    lgssvatlpvkteteftkavkevfryddrlmveprirgreiecavlgngapkaslpgeii
    ttttsesvtkqiqqiaidafkmvhcsgmarvdffvtpnnkvlvneintipgftnismypk
    mweasglpcpnlldqlielaidrhqeqqklircyevk