PDB entry 3tqp

View 3tqp on RCSB PDB site
Description: Structure of an enolase (eno) from Coxiella burnetii
Class: lyase
Keywords: Energy metabolism, LYASE
Deposited on 2011-09-09, released 2011-09-28
The last revision prior to the SCOPe 2.06 freeze date was dated 2015-10-21, with a file datestamp of 2015-10-16.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: N/A
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: enolase
    Species: Coxiella burnetii [TaxId:777]
    Gene: eno, CBU_1674
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3tqpa1, d3tqpa2
  • Chain 'B':
    Compound: enolase
    Species: Coxiella burnetii [TaxId:777]
    Gene: eno, CBU_1674
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3tqpb1, d3tqpb2
  • Heterogens: PO4, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3tqpA (A:)
    mtatitdinaheildsranptlevrvtlssqaygcaavpsgastgereavelrdndlery
    ggkgvlqavenvngpirdallgqdprsqeeidrimieldgtenkanlganailgvslava
    yaaannadlplyrylggdggpfsmpvpmmniinggahatnnldfqefmivpvgaptfaea
    lrygaevfhalkkrlvsrglmsavgdeggfapdlpnneaafelileaiedanyvpgkdiy
    laldaasselyqngrydfennqltseemidrltewtkkypvisiedglsendwagwkllt
    erlenkvqlvgddifvtnpdilekgikknianailvklnqigtltetlatvglaksnkyg
    viishrsgetedttiadlavatdarqiktgslcrsdrvakynrllqierelndqapyagk
    eaflfnrk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3tqpA (A:)
    tatitdinaheildsranptlevrvtlssqaygcaavpsgaereavelrdndleryggkg
    vlqavenvngpirdallgqdprsqeeidrimieldgtenkanlganailgvslavayaaa
    nnadlplyrylggdggpfsmpvpmmniinggnnldfqefmivpvgaptfaealrygaevf
    halkkrlvsrglmsavgdeggfapdlpnneaafelileaiedanyvpgkdiylaldaass
    elyqngrydfennqltseemidrltewtkkypvisiedglsendwagwkllterlenkvq
    lvgddifvtnpdilekgikknianailvklnqigtltetlatvglaksnkygviishrsg
    etedttiadlavatdarqiktgslcrsdrvakynrllqierelndqapyagkeaflfn
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3tqpB (B:)
    mtatitdinaheildsranptlevrvtlssqaygcaavpsgastgereavelrdndlery
    ggkgvlqavenvngpirdallgqdprsqeeidrimieldgtenkanlganailgvslava
    yaaannadlplyrylggdggpfsmpvpmmniinggahatnnldfqefmivpvgaptfaea
    lrygaevfhalkkrlvsrglmsavgdeggfapdlpnneaafelileaiedanyvpgkdiy
    laldaasselyqngrydfennqltseemidrltewtkkypvisiedglsendwagwkllt
    erlenkvqlvgddifvtnpdilekgikknianailvklnqigtltetlatvglaksnkyg
    viishrsgetedttiadlavatdarqiktgslcrsdrvakynrllqierelndqapyagk
    eaflfnrk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3tqpB (B:)
    tatitdinaheildsranptlevrvtlssqaygcaavpsreavelrdndleryggkgvlq
    avenvngpirdallgqdprsqeeidrimieldgtenkanlganailgvslavayaaanna
    dlplyrylggdggpfsmpvpmmniingnfqefmivpvgaptfaealrygaevfhalkkrl
    vsrglmsavgdeggfaplpnneaafelileaiedanyvpgkdiylaldaasselygydnn
    qltseemidrltewtkkypvisiedglsendwagwkllterlenkvqlvgddifvtnpdi
    lekgikknianailvklnqigtltetlatvglaksnkygviishrsgetedttiadlava
    tdarqiktgslcrsdrvakynrllqierelndqapyagkeaflf