PDB entry 3tqj

View 3tqj on RCSB PDB site
Description: Structure of the superoxide dismutase (Fe) (sodB) from Coxiella burnetii
Class: oxidoreductase
Keywords: superoxide dismutase (Fe), OXIDOREDUCTASE
Deposited on 2011-09-09, released 2011-09-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-01-20, with a file datestamp of 2016-01-15.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: superoxide dismutase [fe]
    Species: Coxiella burnetii [TaxId:777]
    Gene: CBU_1708, sodB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3tqja1, d3tqja2
  • Chain 'B':
    Compound: superoxide dismutase [fe]
    Species: Coxiella burnetii [TaxId:777]
    Gene: CBU_1708, sodB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3tqjb1, d3tqjb2
  • Heterogens: FE2, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3tqjA (A:)
    mafelpdlpyklnalephisqetleyhhgkhhrayvnklnkliegtpfekepleeiirks
    dggifnnaaqhwnhtfywhcmspdgggdpsgelasaidktfgslekfkalftdsannhfg
    sgwawlvkdnngklevlstvnarnpmtegkkplmtcdvwehayyidtrndrpkyvnnfwq
    vvnwdfvmknfksenlyfqghhhhhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3tqjA (A:)
    afelpdlpyklnalephisqetleyhhgkhhrayvnklnkliegtpfekepleeiirksd
    ggifnnaaqhwnhtfywhcmspdgggdpsgelasaidktfgslekfkalftdsannhfgs
    gwawlvkdnngklevlstvnarnpmtegkkplmtcdvwehayyidtrndrpkyvnnfwqv
    vnwdfvmknfks
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3tqjB (B:)
    mafelpdlpyklnalephisqetleyhhgkhhrayvnklnkliegtpfekepleeiirks
    dggifnnaaqhwnhtfywhcmspdgggdpsgelasaidktfgslekfkalftdsannhfg
    sgwawlvkdnngklevlstvnarnpmtegkkplmtcdvwehayyidtrndrpkyvnnfwq
    vvnwdfvmknfksenlyfqghhhhhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3tqjB (B:)
    afelpdlpyklnalephisqetleyhhgkhhrayvnklnkliegtpfekepleeiirksd
    ggifnnaaqhwnhtfywhcmspdgggdpsgelasaidktfgslekfkalftdsannhfgs
    gwawlvkdnngklevlstvnarnpmtegkkplmtcdvwehayyidtrndrpkyvnnfwqv
    vnwdfvmknfks