PDB entry 3tqg

View 3tqg on RCSB PDB site
Description: Structure of the 2-methylcitrate synthase (prpC) from Coxiella burnetii
Class: transferase
Keywords: Energy metabolism, TRANSFERASE
Deposited on 2011-09-09, released 2011-09-28
The last revision prior to the SCOPe 2.06 freeze date was dated 2015-06-24, with a file datestamp of 2015-06-19.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 2-methylcitrate synthase
    Species: Coxiella burnetii [TaxId:777]
    Gene: CBU_0772, prpC
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3tqga_
  • Chain 'B':
    Compound: 2-methylcitrate synthase
    Species: Coxiella burnetii [TaxId:777]
    Gene: CBU_0772, prpC
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3tqgb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3tqgA (A:)
    snamtktakglrgqsagetsiatvgkeghgltyrgyriedlaanatfeevaylllknklp
    tkseldaytkklvnlrslppalkdtleripasshpmdvmrtgcsmlgnlepengfeneqn
    iadrlvaifpaiqcywyhyshhgkridtelddltlagyflhlllgkkaaqmaidcmnasl
    ilyaehefnastfaarvcsatlsdiysavtaaiatlrgplhgganeaamdlimlyktpse
    aiagikrklankelimgfghavyrerdprnaiikswaqklapnaadgylfdisdaientm
    qdekklfpnldfysatayhflniptklftpifvmsrvtgwcahifeqrkdnriirpnady
    igpeeqgwvpiekrr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3tqgA (A:)
    agetsiatvgkeghgltyrgyriedlaanatfeevaylllknklptkseldaytkklvnl
    rslppalkdtleripasshpmdvmrtgcsmlgnlepengfeneqniadrlvaifpaiqcy
    wyhyshhgkridtelddltlagyflhlllgkkaaqmaidcmnaslilyaehefnastfaa
    rvcsatlsdiysavtaaiatlrgplhgganeaamdlimlyktpseaiagikrklankeli
    mgfghavyrerdprnaiikswaqklapnaadgylfdisdaientmqdekklfpnldfysa
    tayhflniptklftpifvmsrvtgwcahifeqrkdnriirpnadyigpeeqgwvpiekrr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3tqgB (B:)
    snamtktakglrgqsagetsiatvgkeghgltyrgyriedlaanatfeevaylllknklp
    tkseldaytkklvnlrslppalkdtleripasshpmdvmrtgcsmlgnlepengfeneqn
    iadrlvaifpaiqcywyhyshhgkridtelddltlagyflhlllgkkaaqmaidcmnasl
    ilyaehefnastfaarvcsatlsdiysavtaaiatlrgplhgganeaamdlimlyktpse
    aiagikrklankelimgfghavyrerdprnaiikswaqklapnaadgylfdisdaientm
    qdekklfpnldfysatayhflniptklftpifvmsrvtgwcahifeqrkdnriirpnady
    igpeeqgwvpiekrr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3tqgB (B:)
    qsagetsiatvgkeghgltyrgyriedlaanatfeevaylllknklptkseldaytkklv
    nlrslppalkdtleripasshpmdvmrtgcsmlgnlepengfeneqniadrlvaifpaiq
    cywyhyshhgkridtelddltlagyflhlllgkkaaqmaidcmnaslilyaehefnastf
    aarvcsatlsdiysavtaaiatlrgplhgganeaamdlimlyktpseaiagikrklanke
    limgfghavyrerdprnaiikswaqklapnaadgylfdisdaientmqdekklfpnldfy
    satayhflniptklftpifvmsrvtgwcahifeqrkdnriirpnadyigpeeqgwvpiek
    rr