PDB entry 3tp2

View 3tp2 on RCSB PDB site
Description: Crystal Structure of the Splicing Factor Cwc2 from yeast
Class: splicing
Keywords: RNA scaffold, Torus domain, CCCH zinc finger, RRM domain, SPLICING
Deposited on 2011-09-07, released 2012-03-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-05-16, with a file datestamp of 2012-05-11.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.223
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Pre-mRNA-splicing factor CWC2
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: CWC2, NTC40, SLC3, YDL209C, D1041
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3tp2a1, d3tp2a2
  • Chain 'B':
    Compound: Pre-mRNA-splicing factor CWC2
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: CWC2, NTC40, SLC3, YDL209C, D1041
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3tp2b1, d3tp2b2
  • Heterogens: NA, ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3tp2A (A:)
    gamtswrdksakvqvkeselpssipaqtgltfniwynkwsqgfagntrfvspfalqpqlh
    sgktrgdndgqlffclffakgmcclgpkceylhhipdeedigklalrtevldcfgrekfa
    dyredmggigsfrkknktlyvggidgalnskhlkpaqiesrirfvfsrlgdidriryves
    kncgfvkfkyqanaefakeamsnqtlllpsdkewddrregtgllvkwan
    

    Sequence, based on observed residues (ATOM records): (download)
    >3tp2A (A:)
    swrdksakvqvkeselpssipaqtgltfniwynkwsqgfagntrfvspfalqpqlhsgkt
    rgdndgqlffclffakgmcclgpkceylhhipdeedigklalrtevldcfgrekfadyre
    dmggigsfrkknktlyvggidgalnskhlkpaqiesrirfvfsrlgdidriryveskncg
    fvkfkyqanaefakeamsnqtlllpsdkewddrregtgllvkwan
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3tp2B (B:)
    gamtswrdksakvqvkeselpssipaqtgltfniwynkwsqgfagntrfvspfalqpqlh
    sgktrgdndgqlffclffakgmcclgpkceylhhipdeedigklalrtevldcfgrekfa
    dyredmggigsfrkknktlyvggidgalnskhlkpaqiesrirfvfsrlgdidriryves
    kncgfvkfkyqanaefakeamsnqtlllpsdkewddrregtgllvkwan
    

    Sequence, based on observed residues (ATOM records): (download)
    >3tp2B (B:)
    swrdksakvqvkeselpssipaqtgltfniwynkwsqgfagntrfvspfalqpqlhsgkt
    rgdndgqlffclffakgmcclgpkceylhhipdeedigklalrtevldcfgreknktlyv
    ggidgalnskhlkpaqiesrirfvfsrlgdidriryveskncgfvkfkyqanaefakeam
    snqtlllpsdkewddrregtgllvkwan