PDB entry 3tp1

View 3tp1 on RCSB PDB site
Description: Crystal Structure of the precatalytic M-PMV dUTPase - substrate (dUPNPP) complex
Class: hydrolase
Keywords: jelly roll, Hydrolase
Deposited on 2011-09-07, released 2011-09-21
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-01-24, with a file datestamp of 2018-01-19.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: N/A
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: deoxyuridine 5'-triphosphate nucleotido hydrolase
    Species: Mason-Pfizer monkey virus [TaxId:11855]
    Gene: gag-pro
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3tp1a_
  • Heterogens: DUP, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >3tp1A (A:)
krvegpapgpetslwgsqlcssqqkqpiskltratpgsagldlcstshtvltpemgpqal
stgiygplppntfglilgrssitmkglqvypgvidndytgeikimakavnnivtvsqgnr
iaqlillplietdnkvqqpyrgqgsfgssdiy

    Sequence, based on observed residues (ATOM records): (download) 
    >3tp1A (A:)
qkqpiskltratpgsagldlcstshtvltpemgpqalstgiygplppntfglilgrssit
mkglqvypgvidndytgeikimakavnnivtvsqgnriaqlillplietdnkvq