PDB entry 3to5

View 3to5 on RCSB PDB site
Description: High resolution structure of CheY3 from Vibrio cholerae
Class: signaling protein
Keywords: alpha(5)beta(5), Chemotaxis, FliM, Phosphorylation, Motor action, SIGNALING PROTEIN
Deposited on 2011-09-04, released 2012-09-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-10-09, with a file datestamp of 2013-10-04.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: 0.202
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: CheY homolog
    Species: Vibrio cholerae [TaxId:666]
    Gene: cheY3, VC_2065
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3to5a_
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3to5A (A:)
    gshmmeailnknmkilivddfstmrrivknllrdlgfnntqeaddgltalpmlkkgdfdf
    vvtdwnmpgmqgidllkniradeelkhlpvlmitaeakreqiieaaqagvngyivkpfta
    atlkekldkiferl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3to5A (A:)
    lnknmkilivddfstmrrivknllrdlgfnntqeaddgltalpmlkkgdfdfvvtdwnmp
    gmqgidllkniradeelkhlpvlmitaeakreqiieaaqagvngyivkpftaatlkekld
    kife