PDB entry 3tny

View 3tny on RCSB PDB site
Description: Structure of YfiY from Bacillus cereus bound to the siderophore iron (III) schizokinen
Class: metal transport
Keywords: schizokinen, bacillus cereus, nutrient binding protein, ABC transporter, METAL TRANSPORT
Deposited on 2011-09-02, released 2012-09-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 1.55 Å
R-factor: N/A
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: YfiY (ABC transport system substrate-binding protein)
    Species: Bacillus cereus [TaxId:1396]
    Gene: yfiY
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3tnya_
  • Heterogens: SKZ, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3tnyA (A:)
    mksnnkeestkednkkevvtvehamgktevpanpkrvviltnegteallelgvkpvgavk
    swtgdpwyphikdkmkdvkvvgdegqvnvetiaslkpdliignkmrhekvyeqlkaiapt
    vfsetlrgewkdnfkfyakalnkekegqkvvadyesrmkdlkgklgdkvnqeismvrfmp
    gdvriyhgdtfsgvilkelgfkrpgdqnkddfaernvskerisamdgdvlfyftfdkgne
    kkgselekeyindplfknlnavkngkaykvddviwntaggviaanlllddiekrfvkhhh
    hhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3tnyA (A:)
    evvtvehamgktevpanpkrvviltnegteallelgvkpvgavkswtgdpwyphikdkmk
    dvkvvgdegqvnvetiaslkpdliignkmrhekvyeqlkaiaptvfsetlrgewkdnfkf
    yakalnkekegqkvvadyesrmkdlkgklgdkvnqeismvrfmpgdvriyhgdtfsgvil
    kelgfkrpgdqnkddfaernvskerisamdgdvlfyftfdkgnekkgselekeyindplf
    knlnavkngkaykvddviwntaggviaanlllddiekrfv