PDB entry 3tnf

View 3tnf on RCSB PDB site
Description: LidA from Legionella in complex with active Rab8a
Class: protein transport
Keywords: Protein transport, vesicular trafficking, GTPase, Legionella pneumophila, Rab8a, vesicle recuitment, LCV, DrrA, SidM, Rab-effector, vesicular transport, GDP/GTP binding Rab-binding, ER, Golgi, Plasmamembrane
Deposited on 2011-09-01, released 2011-11-02
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-11-23, with a file datestamp of 2011-11-18.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.219
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ras-related protein Rab-8A
    Species: Homo sapiens [TaxId:9606]
    Gene: MEL, RAB8, RAB8A
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3tnfa_
  • Chain 'B':
    Compound: LidA
    Species: Legionella pneumophila subsp. pneumophila str. Philadelphia 1 [TaxId:272624]
    Gene: lida, lpg0940
    Database cross-references and differences (RAF-indexed):
  • Heterogens: MG, GNP, MPD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3tnfA (A:)
    ghmdylfkllligdsgvgktcvlfrfsedafnstfistigidfkirtieldgkriklqiw
    dtagqerfrtittayyrgamgimlvyditneksfdnirnwirnieehasadvekmilgnk
    cdvndkrqvskergeklaldygikfmetsakaninvenafftlardikakmdkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3tnfA (A:)
    dylfkllligdsgvgktcvlfrfsedafnstfistigidfkirtieldgkriklqiwdta
    gqerfrtittayyrgamgimlvyditneksfdnirnwirnieehasadvekmilgnkcdv
    ndkrqvskergeklaldygikfmetsakaninvenafftlardikakmdk
    

  • Chain 'B':
    No sequence available.