PDB entry 3tmq

View 3tmq on RCSB PDB site
Description: Crystal structure of a 2-dehydro-3-deoxyphosphooctonate aldolase from Burkholderia pseudomallei in complex with D-arabinose-5-phosphate
Class: transferase
Keywords: SSGCID, Structural Genomics, Seattle Structural Genomics Center for Infectious Disease, aldolase barrel, Transferase
Deposited on 2011-08-31, released 2011-09-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-10-09, with a file datestamp of 2013-10-04.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.181
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 2-dehydro-3-deoxyphosphooctonate aldolase 2
    Species: Burkholderia pseudomallei [TaxId:320372]
    Gene: kdsA, kdsA2, BURPS1710b_3264
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3tmqa_
  • Chain 'B':
    Compound: 2-dehydro-3-deoxyphosphooctonate aldolase 2
    Species: Burkholderia pseudomallei [TaxId:320372]
    Gene: kdsA, kdsA2, BURPS1710b_3264
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q3JP68 (4-284)
      • expression tag (3)
    Domains in SCOPe 2.07: d3tmqb1, d3tmqb2
  • Chain 'C':
    Compound: 2-dehydro-3-deoxyphosphooctonate aldolase 2
    Species: Burkholderia pseudomallei [TaxId:320372]
    Gene: kdsA, kdsA2, BURPS1710b_3264
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q3JP68 (4-End)
      • expression tag (3)
    Domains in SCOPe 2.07: d3tmqc1, d3tmqc2
  • Chain 'D':
    Compound: 2-dehydro-3-deoxyphosphooctonate aldolase 2
    Species: Burkholderia pseudomallei [TaxId:320372]
    Gene: kdsA, kdsA2, BURPS1710b_3264
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3tmqd_
  • Heterogens: A5P, NO3, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3tmqA (A:)
    gpgsmnvaispgvtagnslpfvlfgginvlesldftldvcgeyvavtrklgipfvfkasf
    dkanrssihsyrgvgldeglkifaevkarfgvpvitdvheaeqaapvaeiadvlqvpafl
    arqtdlvvaiakagkpvnvkkpqfmsptqlkhvvskcgevgndrvmlcergssfgydnlv
    vdmlgfrqmaettggcpvifdvthslqcrdplgdasggrrrqvldlaragiavgiaglfl
    eahpdpdrarcdgpsalplhqlegllsqmkaiddlvkrmpaleir
    

    Sequence, based on observed residues (ATOM records): (download)
    >3tmqA (A:)
    mnvaispgvtagnslpfvlfgginvlesldftldvcgeyvavtrklgipfvfkasfdkan
    rssihsyrgvgldeglkifaevkarfgvpvitdvheaeqaapvaeiadvlqvpaflarqt
    dlvvaiakagkpvnvkkpqfmsptqlkhvvskcgevgndrvmlcergssfgydnlvvdml
    gfrqmaettggcpvifdvthslqcrdplgdasggrrrqvldlaragiavgiaglfleahp
    dpdrarcdgpsalplhqlegllsqmkaiddlvkrmpalei
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3tmqB (B:)
    gpgsmnvaispgvtagnslpfvlfgginvlesldftldvcgeyvavtrklgipfvfkasf
    dkanrssihsyrgvgldeglkifaevkarfgvpvitdvheaeqaapvaeiadvlqvpafl
    arqtdlvvaiakagkpvnvkkpqfmsptqlkhvvskcgevgndrvmlcergssfgydnlv
    vdmlgfrqmaettggcpvifdvthslqcrdplgdasggrrrqvldlaragiavgiaglfl
    eahpdpdrarcdgpsalplhqlegllsqmkaiddlvkrmpaleir
    

    Sequence, based on observed residues (ATOM records): (download)
    >3tmqB (B:)
    smnvaispgvtagnslpfvlfgginvlesldftldvcgeyvavtrklgipfvfkasfdka
    nrssihsyrgvgldeglkifaevkarfgvpvitdvheaeqaapvaeiadvlqvpaflarq
    tdlvvaiakagkpvnvkkpqfmsptqlkhvvskcgevgndrvmlcergssfgydnlvvdm
    lgfrqmaettggcpvifdvthslqcrdprqvldlaragiavgiaglfleahpdpdrarcs
    alplhqlegllsqmkaiddlvkrmpaleir
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3tmqC (C:)
    gpgsmnvaispgvtagnslpfvlfgginvlesldftldvcgeyvavtrklgipfvfkasf
    dkanrssihsyrgvgldeglkifaevkarfgvpvitdvheaeqaapvaeiadvlqvpafl
    arqtdlvvaiakagkpvnvkkpqfmsptqlkhvvskcgevgndrvmlcergssfgydnlv
    vdmlgfrqmaettggcpvifdvthslqcrdplgdasggrrrqvldlaragiavgiaglfl
    eahpdpdrarcdgpsalplhqlegllsqmkaiddlvkrmpaleir
    

    Sequence, based on observed residues (ATOM records): (download)
    >3tmqC (C:)
    smnvaispgvtagnslpfvlfgginvlesldftldvcgeyvavtrklgipfvfkasfdka
    nrssihsyrgvgldeglkifaevkarfgvpvitdvheaeqaapvaeiadvlqvpaflarq
    tdlvvaiakagkpvnvkkpqfmsptqlkhvvskcgevgndrvmlcergssfgydnlvvdm
    lgfrqmaettggcpvifdvthslqcrdplgdasggrrrqvldlaragiavgiaglfleah
    pdpdrarcdgpsalplhqlegllsqmkaiddlvkrmpalei
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3tmqD (D:)
    gpgsmnvaispgvtagnslpfvlfgginvlesldftldvcgeyvavtrklgipfvfkasf
    dkanrssihsyrgvgldeglkifaevkarfgvpvitdvheaeqaapvaeiadvlqvpafl
    arqtdlvvaiakagkpvnvkkpqfmsptqlkhvvskcgevgndrvmlcergssfgydnlv
    vdmlgfrqmaettggcpvifdvthslqcrdplgdasggrrrqvldlaragiavgiaglfl
    eahpdpdrarcdgpsalplhqlegllsqmkaiddlvkrmpaleir
    

    Sequence, based on observed residues (ATOM records): (download)
    >3tmqD (D:)
    mnvaispgvtagnslpfvlfgginvlesldftldvcgeyvavtrklgipfvfkasfdkan
    rssihsyrgvgldeglkifaevkarfgvpvitdvheaeqaapvaeiadvlqvpaflarqt
    dlvvaiakagkpvnvkkpqfmsptqlkhvvskcgevgndrvmlcergssfgydnlvvdml
    gfrqmaettggcpvifdvthslqcrrqvldlaragiavgiaglfleahpdpdrsalplhq
    legllsqmkaiddlvkrmpaleir