PDB entry 3tm9

View 3tm9 on RCSB PDB site
Description: Y29A mutant of Vitreoscilla stercoraria hemoglobin
Class: oxygen transport
Keywords: globin 8-helix fold, oxygen storage, OXYGEN TRANSPORT
Deposited on 2011-08-31, released 2014-04-16
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-07-17, with a file datestamp of 2019-07-12.
Experiment type: XRAY
Resolution: 1.72 Å
R-factor: N/A
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Bacterial hemoglobin
  Species: Vitreoscilla stercoraria [TaxId:61]
  Gene: vhb
  Database cross-references and differences (RAF-indexed):
  • Uniprot P04252 (0-145)
    • engineered mutation (28)
  Domains in SCOPe 2.08: d3tm9a_
• Heterogens: HEM, EDO, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3tm9A (A:)
  mldqqtiniikatvpvlkehgvtitttfaknlfakhpevrplfdmgrqesleqpkalamt
  vlaaaqnienlpailpavkkiavkhcqagvaaahypivgqellgaikevlgdaatddild
  awgkaygviadvfiqveadlyaqave