PDB entry 3tm6

View 3tm6 on RCSB PDB site
Description: Crystal structure of the beta-2 microglobulin DIMC50 disulphide-linked homodimer mutant
Class: immune system
Keywords: Immunoglobulin-like fold, MHC class I, Light chain, IMMUNE SYSTEM
Deposited on 2011-08-31, released 2012-09-05
The last revision prior to the SCOPe 2.02 freeze date was dated 2012-09-05, with a file datestamp of 2012-08-31.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.235
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Beta-2-microglobulin
    Species: Homo sapiens [TaxId:9606]
    Gene: B2M, CDABP0092, HDCMA22P
    Database cross-references and differences (RAF-indexed):
    • Uniprot P61769 (1-End)
      • expression tag (0)
      • engineered mutation (50)
    Domains in SCOPe 2.02: d3tm6a_
  • Chain 'B':
    Compound: Beta-2-microglobulin
    Species: Homo sapiens [TaxId:9606]
    Gene: B2M, CDABP0092, HDCMA22P
    Database cross-references and differences (RAF-indexed):
    • Uniprot P61769 (1-End)
      • expression tag (0)
      • engineered mutation (50)
  • Chain 'C':
    Compound: Beta-2-microglobulin
    Species: Homo sapiens [TaxId:9606]
    Gene: B2M, CDABP0092, HDCMA22P
    Database cross-references and differences (RAF-indexed):
    • Uniprot P61769 (1-End)
      • expression tag (0)
      • engineered mutation (50)
  • Chain 'D':
    Compound: Beta-2-microglobulin
    Species: Homo sapiens [TaxId:9606]
    Gene: B2M, CDABP0092, HDCMA22P
    Database cross-references and differences (RAF-indexed):
    • Uniprot P61769 (1-End)
      • expression tag (0)
      • engineered mutation (50)
  • Chain 'E':
    Compound: Beta-2-microglobulin
    Species: Homo sapiens [TaxId:9606]
    Gene: B2M, CDABP0092, HDCMA22P
    Database cross-references and differences (RAF-indexed):
    • Uniprot P61769 (1-End)
      • expression tag (0)
      • engineered mutation (50)
  • Chain 'F':
    Compound: Beta-2-microglobulin
    Species: Homo sapiens [TaxId:9606]
    Gene: B2M, CDABP0092, HDCMA22P
    Database cross-references and differences (RAF-indexed):
    • Uniprot P61769 (1-End)
      • expression tag (0)
      • engineered mutation (50)
  • Chain 'G':
    Compound: Beta-2-microglobulin
    Species: Homo sapiens [TaxId:9606]
    Gene: B2M, CDABP0092, HDCMA22P
    Database cross-references and differences (RAF-indexed):
    • Uniprot P61769 (1-End)
      • expression tag (0)
      • engineered mutation (50)
  • Chain 'H':
    Compound: Beta-2-microglobulin
    Species: Homo sapiens [TaxId:9606]
    Gene: B2M, CDABP0092, HDCMA22P
    Database cross-references and differences (RAF-indexed):
    • Uniprot P61769 (1-End)
      • expression tag (0)
      • engineered mutation (50)
  • Heterogens: PEG, PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3tm6A (A:)
    miqrtpkiqvysrhpaengksnflncyvsgfhpsdievdllkngeriekvchsdlsfskd
    wsfyllyyteftptekdeyacrvnhvtlsqpkivkwdrdm
    

    Sequence, based on observed residues (ATOM records): (download)
    >3tm6A (A:)
    miqrtpkiqvysrhpaengksnflncyvsgfhpsdievdllkngeriekvchsdlsfskd
    wsfyllyyteftptekdeyacrvnhvtlsqpkivkwdrd
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    No sequence available.

  • Chain 'G':
    No sequence available.

  • Chain 'H':
    No sequence available.