PDB entry 3tlk

View 3tlk on RCSB PDB site
Description: Crystal structure of holo FepB
Class: metal transport
Keywords: Ferric-enterobactin, trimer, siderophore transport, Periplasmic space, METAL TRANSPORT
Deposited on 2011-08-30, released 2013-01-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-01-16, with a file datestamp of 2013-01-11.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: 0.18
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ferrienterobactin-binding periplasmic protein
    Species: Escherichia coli [TaxId:83333]
    Gene: b0592, fepB, JW0584
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0AEL6 (Start-317)
      • expression tag (318-321)
    Domains in SCOPe 2.07: d3tlka1, d3tlka2
  • Chain 'B':
    Compound: Ferrienterobactin-binding periplasmic protein
    Species: Escherichia coli [TaxId:83333]
    Gene: b0592, fepB, JW0584
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3tlkb_
  • Chain 'C':
    Compound: Ferrienterobactin-binding periplasmic protein
    Species: Escherichia coli [TaxId:83333]
    Gene: b0592, fepB, JW0584
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0AEL6 (Start-317)
      • expression tag (318-321)
    Domains in SCOPe 2.07: d3tlkc1, d3tlkc2
  • Heterogens: FE, EB4, DIO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3tlkA (A:)
    mrlaplyrnallltglllsgiaavqaadwprqitdsrgthtlesqpqrivstsvtltgsl
    laidapviasgattpnnrvaddqgflrqwskvakerklqrlyigepsaeavaaqmpdlil
    isatggdsalalydqlstiaptliinyddkswqslltqlgeitghekqaaeriaqfdkql
    aaakeqiklppqpvtaivytaaahsanlwtpesaqgqmleqlgftlaklpaglnasqsqg
    krhdiiqlggenlaaglngeslflfagdqkdadaiyanpllahlpavqnkqvyalgtetf
    rldyysamqvldrlkalflehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3tlkA (A:)
    adwprqitdsrgthtlesqpqrivstsvtltgsllaidapviasgattpnnrvaddqgfl
    rqwskvakerklqrlyigepsaeavaaqmpdlilisatggdsalalydqlstiaptliin
    yddkswqslltqlgeitghekqaaeriaqfdkqlaaakeqiklppqpvtaivytaaahsa
    nlwtpesaqgqmleqlgftlaklpaglnasqsqgkrhdiiqlggenlaaglngeslflfa
    gdqkdadaiyanpllahlpavqnkqvyalgtetfrldyysamqvldrlkalflehh
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3tlkB (B:)
    mrlaplyrnallltglllsgiaavqaadwprqitdsrgthtlesqpqrivstsvtltgsl
    laidapviasgattpnnrvaddqgflrqwskvakerklqrlyigepsaeavaaqmpdlil
    isatggdsalalydqlstiaptliinyddkswqslltqlgeitghekqaaeriaqfdkql
    aaakeqiklppqpvtaivytaaahsanlwtpesaqgqmleqlgftlaklpaglnasqsqg
    krhdiiqlggenlaaglngeslflfagdqkdadaiyanpllahlpavqnkqvyalgtetf
    rldyysamqvldrlkalflehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3tlkB (B:)
    dwprqitdsrgthtlesqpqrivstsvtltgsllaidapviasgattpnnrvaddqgflr
    qwskvakerklqrlyigepsaeavaaqmpdlilisatggdsalalydqlstiaptliiny
    ddkswqslltqlgeitghekqaaeriaqfdkqlaaakeqiklppqpvtaivytaaahsan
    lwtpesaqgqmleqlgftlaklpaglnasqsqgkrhdiiqlggenlaaglngeslflfag
    dqkdadaiyanpllahlpavqnkqvyalgtetfrldyysamqvldrlkalf
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3tlkC (C:)
    mrlaplyrnallltglllsgiaavqaadwprqitdsrgthtlesqpqrivstsvtltgsl
    laidapviasgattpnnrvaddqgflrqwskvakerklqrlyigepsaeavaaqmpdlil
    isatggdsalalydqlstiaptliinyddkswqslltqlgeitghekqaaeriaqfdkql
    aaakeqiklppqpvtaivytaaahsanlwtpesaqgqmleqlgftlaklpaglnasqsqg
    krhdiiqlggenlaaglngeslflfagdqkdadaiyanpllahlpavqnkqvyalgtetf
    rldyysamqvldrlkalflehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3tlkC (C:)
    dwprqitdsrgthtlesqpqrivstsvtltgsllaidapviasgattpnnrvaddqgflr
    qwskvakerklqrlyigepsaeavaaqmpdlilisatggdsalalydqlstiaptliiny
    ddkswqslltqlgeitghekqaaeriaqfdkqlaaakeqiklppqpvtaivytaaahsan
    lwtpesaqgqmleqlgftlaklpaglnasqsqgkrhdiiqlggenlaaglngeslflfag
    dqkdadaiyanpllahlpavqnkqvyalgtetfrldyysamqvldrlkalflehh