PDB entry 3tlh

View 3tlh on RCSB PDB site
Description: structural studies of hiv and fiv proteases complexed withan efficient inhibitor of fiv pr
Deposited on 1998-12-03, released 1998-12-09
The last revision prior to the SCOP 1.55 freeze date was dated 2000-02-03, with a file datestamp of 2000-02-03.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.195
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d3tlha_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3tlhA (A:)
    pqitlwkrplvtikiggqlkealldtgaddtvleemslpgrwkpkmiggiggfikvrqyd
    qilieicghkaigtvlvgptpvniigrnlltqigctlnf