PDB entry 3tl9

View 3tl9 on RCSB PDB site
Description: crystal structure of HIV protease model precursor/Saquinavir complex
Class: hydrolase/hydrolase inhibitor
Keywords: Hydrolase, HYDROLASE-HYDROLASE INHIBITOR complex
Deposited on 2011-08-29, released 2012-04-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 1.32 Å
R-factor: N/A
AEROSPACI score: 0.57 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protease
    Species: Human immunodeficiency virus type 1 [TaxId:11686]
    Gene: gag-pol
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03367 (Start-102)
      • conflict (10)
      • conflict (36)
      • conflict (66)
      • conflict (70)
      • conflict (98)
    Domains in SCOPe 2.07: d3tl9a_
  • Chain 'B':
    Compound: Protease
    Species: Human immunodeficiency virus type 1 [TaxId:11686]
    Gene: gag-pol
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03367 (0-102)
      • conflict (10)
      • conflict (36)
      • conflict (66)
      • conflict (70)
      • conflict (98)
    Domains in SCOPe 2.07: d3tl9b_
  • Heterogens: ROC, CL, NA, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3tl9A (A:)
    sfnfpqitlwkrplvtikiggqlkealldtgaddtvieemslpgrwkpkmiggiggfikv
    rqydqiiieiaghkaigtvlvgptpvniigrnlltqigatlnf
    

    Sequence, based on observed residues (ATOM records): (download)
    >3tl9A (A:)
    pqitlwkrplvtikiggqlkealldtgaddtvieemslpgrwkpkmiggiggfikvrqyd
    qiiieiaghkaigtvlvgptpvniigrnlltqigatlnf
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3tl9B (B:)
    sfnfpqitlwkrplvtikiggqlkealldtgaddtvieemslpgrwkpkmiggiggfikv
    rqydqiiieiaghkaigtvlvgptpvniigrnlltqigatlnf