PDB entry 3tl5

View 3tl5 on RCSB PDB site
Description: Discovery of GDC-0980: a Potent, Selective, and Orally Available Class I Phosphatidylinositol 3-Kinase (PI3K)/Mammalian Target of Rapamycin (mTOR) Kinase Inhibitor for the Treatment of Cancer
Class: transferase/transferase inhibitor
Keywords: TRANSFERASE-TRANSFERASE INHIBITOR complex
Deposited on 2011-08-29, released 2011-11-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-11-16, with a file datestamp of 2011-11-11.
Experiment type: XRAY
Resolution: 2.79 Å
R-factor: 0.203
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit gamma isoform
    Species: Homo sapiens [TaxId:9606]
    Gene: PIK3CG
    Database cross-references and differences (RAF-indexed):
    • Uniprot P48736 (1-End)
      • expression tag (0)
    Domains in SCOPe 2.07: d3tl5a1, d3tl5a2, d3tl5a3, d3tl5a4, d3tl5a5
  • Heterogens: 980, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3tl5A (A:)
    mseesqafqrqltaligydvtdvsnvhddeleftrrglvtprmaevasrdpklyamhpwv
    tskplpeylwkkianncifivihrsttsqtikvspddtpgailqsfftkmakkkslmdip
    esqseqdfvlrvcgrdeylvgetpiknfqwvrhclkngeeihvvldtppdpaldevrkee
    wplvddctgvtgyheqltihgkdhesvftvslwdcdrkfrvkirgidipvlprntdltvf
    veaniqhgqqvlcqrrtspkpfteevlwnvwlefsikikdlpkgallnlqiycgkapals
    skasaespsseskgkvqllyyvnlllidhrfllrrgeyvlhmwqisgkgedqgsfnadkl
    tsatnpdkensmsisilldnychpialpkhqptpdpegdrvraempnqlrkqleaiiatd
    plnpltaedkellwhfryeslkhpkaypklfssvkwgqqeivaktyqllarrevwdqsal
    dvgltmqlldcnfsdenvraiavqklesledddvlhyllqlvqavkfepyhdsalarfll
    krglrnkrighflfwflrseiaqsrhyqqrfavileaylrgcgtamlhdftqqvqvieml
    qkvtldikslsaekydvssqvisqlkqklenlqnsqlpesfrvpydpglkagalaiekck
    vmaskkkplwlefkcadptalsnetigiifkhgddlrqdmlilqilrimesiwetesldl
    cllpygcistgdkigmieivkdattiakiqqstvgntgafkdevlnhwlkekspteekfq
    aaverfvyscagycvatfvlgigdrhndnimitetgnlfhidfghilgnyksflginker
    vpfvltpdflfvmgtsgkktsphfqkfqdicvkaylalrhhtnlliilfsmmlmtgmpql
    tskedieyirdaltvgkneedakkyfldqievcrdkgwtvqfnwflhlvlgikqgekhsa
    hhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3tl5A (A:)
    mseesqafqrqltaligydvtdvsnvhddeleftrrglvtprmaevasrdpklyamhpwv
    tskplpeylwkkianncifivihrsttsqtikvspddtpgailqsfftkmaeqdfvlrvc
    grdeylvgetpiknfqwvrhclkngeeihvvldtppdpaldevrkeecdrkfrvkirgid
    ipvlprntdltvfveaniqhgqqvlcqrrtspkpfteevlwnvwlefsikikdlpkgall
    nlqiycllyyvnlllidhrfllrrgeyvlhmwqisgfnadkltsatnpdkensmsisill
    dnychpialpraempnqlrkqleaiiatdplnpltaedkellwhfryeslkhpkaypklf
    ssvkwgqqeivaktyqllarrevwdqsaldvgltmqlldcnfsdenvraiavqklesled
    ddvlhyllqlvqavkfepyhdsalarfllkrglrnkrighflfwflrseiaqsrhyqqrf
    avileaylrgcgtamlhdftqqvqviemlqkvtldikslsaekydvssqvisqlkqklen
    lqnsqlpesfrvpydpglkagalaiekckvmaskkkplwlefkcadptalsnetigiifk
    hgddlrqdmlilqilrimesiwetesldlcllpygcistgdkigmieivkdattiakiqq
    stvgntgafkdevlnhwlkekspteekfqaaverfvyscagycvatfvlgigdrhndnim
    itetgnlfhidfghervpfvltpdflfvmgtsgkktsphfqkfqdicvkaylalrhhtnl
    liilfsmmlmtgmpqltskedieyirdaltvgkneedakkyfldqievcrdkgwtvqfnw
    flhlv