PDB entry 3tl2

View 3tl2 on RCSB PDB site
Description: Crystal structure of Bacillus anthracis str. Ames malate dehydrogenase in closed conformation.
Class: oxidoreductase
Keywords: Center for Structural Genomics of Infectious Diseases, CSGID, dehydrogenase, OXIDOREDUCTASE, citric acid cycle, gluconeogenesis
Deposited on 2011-08-29, released 2011-09-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: N/A
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: malate dehydrogenase
    Species: Bacillus anthracis [TaxId:1392]
    Gene: BAS4486, BA_4837, GBAA_4837, mdh
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3tl2a1, d3tl2a2
  • Heterogens: EDO, SCN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3tl2A (A:)
    snamtikrkkvsvigagftgattafllaqkeladvvlvdipqlenptkgkaldmleaspv
    qgfdaniigtsdyadtadsdvvvitagiarkpgmsrddlvatnskimksitrdiakhspn
    aiivvltnpvdamtysvfkeagfpkervigqsgvldtarfrtfiaqelnlsvkditgfvl
    gghgddmvplvrysyaggipletlipkerleaivertrkgggeivgllgngsayyapaas
    lvemteailkdqrrvlpaiaylegeygysdlylgvpvilggngiekiielelladekeal
    drsvesvrnvmkvlv
    

    Sequence, based on observed residues (ATOM records): (download)
    >3tl2A (A:)
    mtikrkkvsvigagftgattafllaqkeladvvlvdipqlenptkgkaldmleaspvqgf
    daniigtsdyadtadsdvvvitagiarkpgmsrddlvatnskimksitrdiakhspnaii
    vvltnpvdamtysvfkeagfpkervigqsgvldtarfrtfiaqelnlsvkditgfvlggh
    gddmvplvrysyaggipletlipkerleaivertrkgggeivgllgngsayyapaaslve
    mteailkdqrrvlpaiaylegeygysdlylgvpvilggngiekiielelladekealdrs
    vesvrnvmkvlv