PDB entry 3tl1

View 3tl1 on RCSB PDB site
Description: Crystal structure of the Streptomyces coelicolor WhiE ORFVI polyketide aromatase/cyclase
Class: biosynthetic protein
Keywords: Helix-grip fold, polyketide C9-C14 aromatase/cyclase, linear poly-beta-ketone intermediate, BIOSYNTHETIC PROTEIN
Deposited on 2011-08-29, released 2012-04-04
The last revision prior to the SCOPe 2.06 freeze date was dated 2012-04-25, with a file datestamp of 2012-04-20.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.19
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Polyketide cyclase
    Species: Streptomyces coelicolor [TaxId:1902]
    Gene: SCO5315, SC6G9.18
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3tl1a_
  • Chain 'B':
    Compound: Polyketide cyclase
    Species: Streptomyces coelicolor [TaxId:1902]
    Gene: SCO5315, SC6G9.18
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3tl1b_
  • Heterogens: JRO, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3tl1A (A:)
    maghtdneitiaapmelvwnmtndiekwpglfseyasvevlgrdddkvtfrltmhpdadg
    kvwswvservadpvtrtvraqrvetgpfqymnivweyaetaegtvmrwtqdfamkpdapv
    ddawmtdninrnsrtqmalirdrieqaagerrtasvlad
    

    Sequence, based on observed residues (ATOM records): (download)
    >3tl1A (A:)
    maghtdneitiaapmelvwnmtndiekwpglfseyasvevlgrdddkvtfrltmhpdadg
    kvwswvservadpvtrtvraqrvetgpfqymnivweyaetaegtvmrwtqdfamkpdapv
    ddawmtdninrnsrtqmalirdrieqaagerrtasvla
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3tl1B (B:)
    maghtdneitiaapmelvwnmtndiekwpglfseyasvevlgrdddkvtfrltmhpdadg
    kvwswvservadpvtrtvraqrvetgpfqymnivweyaetaegtvmrwtqdfamkpdapv
    ddawmtdninrnsrtqmalirdrieqaagerrtasvlad
    

    Sequence, based on observed residues (ATOM records): (download)
    >3tl1B (B:)
    maghtdneitiaapmelvwnmtndiekwpglfseyasvevlgrdddkvtfrltmhpdadg
    kvwswvservadpvtrtvraqrvetgpfqymnivweyaetaegtvmrwtqdfamkpdapv
    ddawmtdninrnsrtqmalirdrieqaagerrtasvla