PDB entry 3tk9

View 3tk9 on RCSB PDB site
Description: Crystal structure of human granzyme H
Class: Hydrolase
Keywords: serine protease, Hydrolase, Cytolysis
Deposited on 2011-08-25, released 2011-12-28
The last revision prior to the SCOPe 2.04 freeze date was dated 2013-07-03, with a file datestamp of 2013-06-28.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.252
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Granzyme H
    Species: Homo sapiens [TaxId:9606]
    Gene: GZMH, CGL2, CTSGL2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P20718 (0-225)
      • engineered mutation (87)
    Domains in SCOPe 2.04: d3tk9a_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3tk9A (A:)
    iiggheakphsrpymafvqflqeksrkrcggilvrkdfvltaahcqgssinvtlgahnik
    eqertqqfipvkrpiphpaynpknfsnnimllqlerkakwttavrplrlpsskaqvkpgq
    lcsvagwgyvsmstlattlqevlltvqkdcqcerlfhgnysrateicvgdpkktqtgfkg
    dsggplvckdvaqgilsygnkkgtppgvyikvshflpwikrtmkrl