PDB entry 3tjt

View 3tjt on RCSB PDB site
Description: Crystal Structure Analysis of the superoxide dismutase from Clostridium difficile
Class: oxidoreductase
Keywords: Superoxide Dismutase, METAL ION Binding, Rossmann Fold, OXIDOREDUCTASE
Deposited on 2011-08-25, released 2012-08-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-08-29, with a file datestamp of 2012-08-24.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.181
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: superoxide dismutase
    Species: Clostridium difficile [TaxId:272563]
    Gene: CD630_16310, sodA, YP_001088132.1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3tjta1, d3tjta2
  • Heterogens: FE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3tjtA (A:)
    pennkfkvkplpyaydalepyidketmklhhdkhyqayvdklnaalekypelynyslcel
    lqnldslpkdiattvrnnaggaynhkfffdimtpektipseslkeaidrdfgsfekfkqe
    fqksaldvfgsgwawlvatkdgklsimttpnqdspvsknltpiigldvwehayylkyqnr
    rneyidnwfnvvnwngalenyknlksqd
    

    Sequence, based on observed residues (ATOM records): (download)
    >3tjtA (A:)
    nnkfkvkplpyaydalepyidketmklhhdkhyqayvdklnaalekypelynyslcellq
    nldslpkdiattvrnnaggaynhkfffdimtpektipseslkeaidrdfgsfekfkqefq
    ksaldvfgsgwawlvatkdgklsimttpnqdspvsknltpiigldvwehayylkyqnrrn
    eyidnwfnvvnwngalenyknl