PDB entry 3tj3

View 3tj3 on RCSB PDB site
Description: Structure of importin a5 bound to the N-terminus of Nup50
Class: protein transport
Keywords: ARMADILLO repeat, nuclear import adaptor, NLS-bearing proteins, nucleo-cytoplasmic shuttling, PROTEIN TRANSPORT
Deposited on 2011-08-23, released 2011-11-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-02-11, with a file datestamp of 2015-02-06.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.217
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Importin subunit alpha-1
    Species: Homo sapiens [TaxId:9606]
    Gene: KPNA1, RCH2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3tj3a_
  • Chain 'B':
    Compound: Importin subunit alpha-1
    Species: Homo sapiens [TaxId:9606]
    Gene: KPNA1, RCH2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3tj3b_
  • Chain 'C':
    Compound: Nuclear pore complex protein Nup50
    Species: Homo sapiens [TaxId:9606]
    Gene: NUP50, NPAP60L, PRO1146
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9UKX7 (5-End)
      • expression tag (1-4)
  • Chain 'D':
    Compound: Nuclear pore complex protein Nup50
    Species: Homo sapiens [TaxId:9606]
    Gene: NUP50, NPAP60L, PRO1146
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9UKX7 (5-End)
      • expression tag (1-4)
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3tj3A (A:)
    gfheaqisnmemapggvitsdmiemifskspeqqlsatqkfrkllskepnppidevistp
    gvvarfveflkrkenctlqfesawvltniasgnslqtriviqagavpifiellssefedv
    qeqavwalgniagdstmcrdyvldcnilppllqlfskqnrltmtrnavwalsnlcrgksp
    ppefakvspclnvlswllfvsdtdvladacwalsylsdgpndkiqavidagvcrrlvell
    mhndykvvspalravgnivtgddiqtqvilncsalqsllhllsspkesikkeacwtisni
    tagnraqiqtvidanifpalisilqtaefrtrkeaawaitnatsggsaeqikylvelgci
    kplcdlltvmdskivqvalnglenilrlgeqeakrngtginpycalieeaygldkieflq
    shenqeiyqkafdliehyfgtededss
    

    Sequence, based on observed residues (ATOM records): (download)
    >3tj3A (A:)
    vitsdmiemifskspeqqlsatqkfrkllskepnppidevistpgvvarfveflkrkenc
    tlqfesawvltniasgnslqtriviqagavpifiellssefedvqeqavwalgniagdst
    mcrdyvldcnilppllqlfskqnrltmtrnavwalsnlcrgkspppefakvspclnvlsw
    llfvsdtdvladacwalsylsdgpndkiqavidagvcrrlvellmhndykvvspalravg
    nivtgddiqtqvilncsalqsllhllsspkesikkeacwtisnitagnraqiqtvidani
    fpalisilqtaefrtrkeaawaitnatsggsaeqikylvelgcikplcdlltvmdskivq
    valnglenilrlgeqeakrngtginpycalieeaygldkieflqshenqeiyqkafdlie
    hyfgte
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3tj3B (B:)
    gfheaqisnmemapggvitsdmiemifskspeqqlsatqkfrkllskepnppidevistp
    gvvarfveflkrkenctlqfesawvltniasgnslqtriviqagavpifiellssefedv
    qeqavwalgniagdstmcrdyvldcnilppllqlfskqnrltmtrnavwalsnlcrgksp
    ppefakvspclnvlswllfvsdtdvladacwalsylsdgpndkiqavidagvcrrlvell
    mhndykvvspalravgnivtgddiqtqvilncsalqsllhllsspkesikkeacwtisni
    tagnraqiqtvidanifpalisilqtaefrtrkeaawaitnatsggsaeqikylvelgci
    kplcdlltvmdskivqvalnglenilrlgeqeakrngtginpycalieeaygldkieflq
    shenqeiyqkafdliehyfgtededss
    

    Sequence, based on observed residues (ATOM records): (download)
    >3tj3B (B:)
    vitsdmiemifskspeqqlsatqkfrkllskepnppidevistpgvvarfveflkrkenc
    tlqfesawvltniasgnslqtriviqagavpifiellssefedvqeqavwalgniagdst
    mcrdyvldcnilppllqlfskqnrltmtrnavwalsnlcrgkspppefakvspclnvlsw
    llfvsdtdvladacwalsylsdgpndkiqavidagvcrrlvellmhndykvvspalravg
    nivtgddiqtqvilncsalqsllhllsspkesikkeacwtisnitagnraqiqtvidani
    fpalisilqtaefrtrkeaawaitnatsggsaeqikylvelgcikplcdlltvmdskivq
    valnglenilrlgeqeakrngtginpycalieeaygldkieflqshenqeiyqkafdlie
    hyfgte
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.