PDB entry 3thm

View 3thm on RCSB PDB site
Description: Crystal structure of Fas receptor extracellular domain in complex with Fab EP6b_B01
Class: immune system
Keywords: Agonistic antibody, Fab fragment, antibody-receptor complex, tumor necrosis factor receptor, cysteine-rich domain, Fas, IMMUNE SYSTEM
Deposited on 2011-08-19, released 2012-05-09
The last revision prior to the SCOPe 2.06 freeze date was dated 2012-06-27, with a file datestamp of 2012-06-22.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.185
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'F':
    Compound: Tumor necrosis factor receptor superfamily member 6
    Species: Homo sapiens [TaxId:9606]
    Gene: APT1, FAS, FAS1, TNFRSF6
    Database cross-references and differences (RAF-indexed):
  • Chain 'H':
    Compound: Fab EP6b_B01, heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3THM (0-End)
  • Chain 'L':
    Compound: Fab EP6b_B01, light chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3THM (0-End)
    Domains in SCOPe 2.06: d3thml1, d3thml2
  • Heterogens: EDO, HOH

PDB Chain Sequences:

  • Chain 'F':
    No sequence available.

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence, based on SEQRES records: (download) 
    >3thmL (L:)
qsvltqppsvseaprqtvtiscsgnssnigrypvnwyqqlpgkapklliysdnlrfsgvp
drfsgsksgttaslairdllsedeadyycstwddtlegwvfgggtkvtvlgqpkaapsvt
lfppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskqsnnkyaass
ylsltpeqwkshrsyscqvthegstvektvaptecs

    Sequence, based on observed residues (ATOM records): (download) 
    >3thmL (L:)
qsvltqppsvseaprqtvtiscsgnssnigrypvnwyqqlpgkapklliysdnlrfsgvp
drfsgsksgttaslairdllsedeadyycstwddtlegwvfgggtkvtvlgqpkaapsvt
lfppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskqsnnkyaass
ylsltpeqwkshrsyscqvthegstvektvapte