PDB entry 3tgi

View 3tgi on RCSB PDB site
Description: wild-type rat anionic trypsin complexed with bovine pancreatic trypsin inhibitor (bpti)
Deposited on 1998-07-15, released 1998-12-23
The last revision prior to the SCOP 1.55 freeze date was dated 1998-12-23, with a file datestamp of 1998-12-23.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.177
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'E':
    Domains in SCOP 1.55: d3tgie_
  • Chain 'I':
    Domains in SCOP 1.55: d3tgii_

PDB Chain Sequences:

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >3tgiE (E:)
ivggytcqensvpyqvslnsgyhfcggslindqwvvsaahcyksriqvrlgehninvleg
neqfvnaakiikhpnfdrktlnndimliklsspvklnarvatvalpsscapagtqclisg
wgntlssgvnepdllqcldapllpqadceasypgkitdnmvcvgfleggkdscqgdsggp
vvcngelqgivswgygcalpdnpgvytkvcnyvdwiqdtiaan

  • Chain 'I':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >3tgiI (I:)
rpdfcleppytgpckariiryfynakaglcqtfvyggcrakrnnfksaedcmrtcg