PDB entry 3tgg

View 3tgg on RCSB PDB site
Description: A novel series of potent and selective PDE5 inhibitor2
Class: hydrolase/hydrolase inhibitor
Keywords: phosphodiesterase, HYDROLASE, HYDROLASE-HYDROLASE INHIBITOR complex
Deposited on 2011-08-17, released 2012-01-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-01-25, with a file datestamp of 2012-01-20.
Experiment type: XRAY
Resolution: 1.91 Å
R-factor: 0.188
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cGMP-specific 3',5'-cyclic phosphodiesterase
    Species: Homo sapiens [TaxId:9606]
    Gene: PDE5A, PDE5
    Database cross-references and differences (RAF-indexed):
    • Uniprot O76074 (Start-325)
      • engineered mutation (124)
      • expression tag (127)
      • engineered mutation (129-131)
      • expression tag (133)
      • engineered mutation (134-135)
      • engineered mutation (140-141)
      • expression tag (143)
      • engineered mutation (144-145)
      • engineered mutation (147)
      • engineered mutation (147)
      • engineered mutation (218)
    Domains in SCOPe 2.07: d3tgga_
  • Heterogens: ZN, MG, 0H3, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3tggA (A:)
    eeetrelqslaaavvpsaqtlkitdfsfsdfelsdletalctirmftdlnlvqnfqmkhe
    vlcrwilsvkknyrknvayhnwrhafntaqcmfaalkagkiqnkltdleilalliaalsh
    dldhpgvsnqflintnselalmyndesvlehhhfdqclmilnspgnqilsglsieeyktt
    lkiikqailatdlalyikrrgeffelirknqfnledphekelflamlmtacdlsaitkpw
    piqqriaelvateffdqgdrerkelnieptdlmnrekknkipsmqvgfidaiclqlyeal
    thvsedcfplldgcrknrqkwqalae
    

    Sequence, based on observed residues (ATOM records): (download)
    >3tggA (A:)
    etrelqslaaavvpsaqtlkitdfsfsdfelsdletalctirmftdlnlvqnfqmkhevl
    crwilsvkknyrknvayhnwrhafntaqcmfaalkagkiqnkltdleilalliaalshdl
    dhpgvsnqflintnselalmyndesvlehhhfdqclmilnspgnqilsglsieeykttlk
    iikqailatdlalyikrrgeffelirknqfnledphekelflamlmtacdlsaitkpwpi
    qqriaelvateffdqgdrerkelnieptdlmnrekknkipsmqvgfidaiclqlyealth
    vsedcfplldgcrknrqkwqalae