PDB entry 3tge

View 3tge on RCSB PDB site
Description: A novel series of potent and selective PDE5 inhibitor1
Class: hydrolase/hydrolase inhibitor
Keywords: HYDROLASE-HYDROLASE INHIBITOR complex
Deposited on 2011-08-17, released 2011-11-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-08-16, with a file datestamp of 2017-08-11.
Experiment type: XRAY
Resolution: 1.96 Å
R-factor: N/A
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cGMP-specific 3',5'-cyclic phosphodiesterase
    Species: Homo sapiens [TaxId:9606]
    Gene: PDE5A, PDE5
    Database cross-references and differences (RAF-indexed):
    • Uniprot O76074 (Start-122)
    • PDB 3TGE (123-147)
    • Uniprot O76074 (149-325)
      • conflict (218)
    Domains in SCOPe 2.07: d3tgea_
  • Heterogens: ZN, MG, TGE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3tgeA (A:)
    eeetrelqslaaavvpsaqtlkitdfsfsdfelsdletalctirmftdlnlvqnfqmkhe
    vlcrwilsvkknyrknvayhnwrhafntaqcmfaalkagkiqnkltdleilalliaalsh
    dldhpgvsnqflintnselalmyndesvlehhhfdqclmilnspgnqilsglsieeyktt
    lkiikqailatdlalyikrrgeffelirknqfnledphekelflamlmtacdlsaitkpw
    piqqriaelvateffdqgdrerkelnieptdlmnrekknkipsmqvgfidaiclqlyeal
    thvsedcfplldgcrknrqkwqalae
    

    Sequence, based on observed residues (ATOM records): (download)
    >3tgeA (A:)
    etrelqslaaavvpsaqtlkitdfsfsdfelsdletalctirmftdlnlvqnfqmkhevl
    crwilsvkknyrknvayhnwrhafntaqcmfaalkagkiqnkltdleilalliaalshdl
    dhpgvsnqflintnselalmyndesvlehhhfdqclmilnspgnqilsglsieeykttlk
    iikqailatdlalyikrrgeffelirknqfnledphekelflamlmtacdlsaitkpwpi
    qqriaelvateffdqgdrerkelnieptdlmnrekknkipsmqvgfidaiclqlyealth
    vsedcfplldgcrknrqkwqalae