PDB entry 3tef

View 3tef on RCSB PDB site
Description: Crystal Structure of the Periplasmic Catecholate-Siderophore Binding Protein VctP from Vibrio Cholerae
Class: Transport Protein
Keywords: siderophore-binding protein, Transport Protein
Deposited on 2011-08-13, released 2012-08-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-08-15, with a file datestamp of 2012-08-10.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.192
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Iron(III) ABC transporter, periplasmic iron-compound-binding protein
    Species: Vibrio cholerae [TaxId:666]
    Gene: VC_A0227
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3tefa_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3tefA (A:)
    metvtiehrlgkttleqkpqrvvvigvgaldaidsfgiepvavskfdgtpdylakyksdk
    ypsagslfepdfetiytqkpdlivigprasksydelskiaptivfaaeadqgywestqqq
    wrnlgkvfaiepaveakieqvdaqfksimqynqqhksdamlvmssggnlttfgansrfss
    vykdfgfsetvpvskesshgdlisfeyirehnpktllvvdrdkvvtkgetnirqtfendl
    vkattayknghiayldvnawyiaisgvkateqmvadmkasvgmqlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3tefA (A:)
    etvtiehrlgkttleqkpqrvvvigvgaldaidsfgiepvavskfdgtpdylakyksdky
    psagslfepdfetiytqkpdlivigprasksydelskiaptivfaaeadqgywestqqqw
    rnlgkvfaiepaveakieqvdaqfksimqynqqhksdamlvmssggnlttfgansrfssv
    ykdfgfsetvpvskesshgdlisfeyirehnpktllvvdrdkvvtkgetnirqtfendlv
    kattayknghiayldvnawyiaisgvkateqmvadmkas