PDB entry 3tdh
View 3tdh on RCSB PDB site
Description: Structure of the regulatory fragment of sccharomyces cerevisiae AMPK in complex with AMP
Class: transferase
Keywords: CBS domain, Nucleotide binding, cytosol, TRANSFERASE
Deposited on
2011-08-11, released
2011-11-09
The last revision prior to the SCOPe 2.01 freeze date was dated
2011-11-23, with a file datestamp of
2011-11-18.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.25
AEROSPACI score: 0.31
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: Carbon catabolite-derepressing protein kinase
Species: Saccharomyces cerevisiae [TaxId:559292]
Gene: SNF1, CAT1, CCR1, GLC2, PAS14, YDR477W, D8035.20
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.01: d3tdha_ - Chain 'B':
Compound: SNF1 protein kinase subunit beta-2
Species: Saccharomyces cerevisiae [TaxId:559292]
Gene: SIP2, SPM2, YGL208W, G1155
Database cross-references and differences (RAF-indexed):
- Chain 'C':
Compound: Nuclear protein SNF4
Species: Saccharomyces cerevisiae [TaxId:559292]
Gene: SNF4, CAT3, YGL115W
Database cross-references and differences (RAF-indexed):
- Heterogens: AMP, HOH
PDB Chain Sequences:
- Chain 'A':
Sequence, based on SEQRES records: (download)
>3tdhA (A:)
gpmdqykeedstvsilptslpqihranmlaqgspaaskisplvtkksktrwhfgirsrsy
pldvmgeiyialknlgaewakpseedlwtiklrwkydignktntnekipdlmkmviqlfq
ietnnylvdfkfdgwessygddttvsnisedemstfsaypflhlttklimelavnsqsn
Sequence, based on observed residues (ATOM records): (download)
>3tdhA (A:)
stvsilptslpqihranmlaqgspaaskisplvtkksktrwhfgirsrsypldvmgeiyi
alknlgaewakpseedlwtiklrwkyipdlmkmviqlfqietnnylvdfkfdgwesstfs
aypflhlttklimelavns
- Chain 'B':
No sequence available.
- Chain 'C':
No sequence available.