PDB entry 3tdh

View 3tdh on RCSB PDB site
Description: Structure of the regulatory fragment of sccharomyces cerevisiae AMPK in complex with AMP
Class: transferase
Keywords: CBS domain, Nucleotide binding, cytosol, TRANSFERASE
Deposited on 2011-08-11, released 2011-11-09
The last revision prior to the SCOPe 2.01 freeze date was dated 2011-11-23, with a file datestamp of 2011-11-18.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.25
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Carbon catabolite-derepressing protein kinase
    Species: Saccharomyces cerevisiae [TaxId:559292]
    Gene: SNF1, CAT1, CCR1, GLC2, PAS14, YDR477W, D8035.20
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d3tdha_
  • Chain 'B':
    Compound: SNF1 protein kinase subunit beta-2
    Species: Saccharomyces cerevisiae [TaxId:559292]
    Gene: SIP2, SPM2, YGL208W, G1155
    Database cross-references and differences (RAF-indexed):
    • Uniprot P34164 (1-End)
      • expression tag (0)
  • Chain 'C':
    Compound: Nuclear protein SNF4
    Species: Saccharomyces cerevisiae [TaxId:559292]
    Gene: SNF4, CAT3, YGL115W
    Database cross-references and differences (RAF-indexed):
  • Heterogens: AMP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3tdhA (A:)
    gpmdqykeedstvsilptslpqihranmlaqgspaaskisplvtkksktrwhfgirsrsy
    pldvmgeiyialknlgaewakpseedlwtiklrwkydignktntnekipdlmkmviqlfq
    ietnnylvdfkfdgwessygddttvsnisedemstfsaypflhlttklimelavnsqsn
    

    Sequence, based on observed residues (ATOM records): (download)
    >3tdhA (A:)
    stvsilptslpqihranmlaqgspaaskisplvtkksktrwhfgirsrsypldvmgeiyi
    alknlgaewakpseedlwtiklrwkyipdlmkmviqlfqietnnylvdfkfdgwesstfs
    aypflhlttklimelavns
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.