PDB entry 3tdc

View 3tdc on RCSB PDB site
Description: Crystal Structure of Human Acetyl-CoA carboxylase 2
Class: ligase/ligase inhibitor
Keywords: biotin, malonyl-CoA, carboxylase, LIGASE-LIGASE INHIBITOR complex
Deposited on 2011-08-10, released 2011-10-12
The last revision prior to the SCOPe 2.04 freeze date was dated 2011-11-16, with a file datestamp of 2011-11-11.
Experiment type: XRAY
Resolution: 2.41 Å
R-factor: 0.172
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Acetyl-CoA carboxylase 2 variant
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3tdca1, d3tdca2
  • Heterogens: 0EU, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3tdcA (A:)
    mlintpyvtkdllqakrfqaqtlgttyiydfpemfrqalfklwgspdkypkdiltytelv
    ldsqgqlvemnrlpggnevgmvafkmrfktqeypegrdvivignditfrigsfgpgedll
    ylrasemaraegipkiyvaansgarigmaeeikhmfhvawvdpedphkgfkylyltpqdy
    trisslnsvhckhieeggesrymitdiigkddglgvenlrgsgmiagesslayeeivtis
    lvtcraigigaylvrlgqrviqvenshiiltgasalnkvlgrevytsnnqlggvqimhyn
    gvshitvpddfegvytilewlsympkdnhspvpiitptdpidreieflpsrapydprwml
    agrphptlkgtwqsgffdhgsfkeimapwaqtvvtgrarlggipvgviavetrtvevavp
    adpanldseakiiqqagqvwfpdsayktaqaikdfnreklplmifanwrgfsggmkdmyd
    qvlkfgayivdglrqykqpiliyippyaelrggswvvidatinplciemyadkesrggvl
    epegtveikfrkkdliksmrridpaykklmeqlgepdlsdkdrkdlegrlkaredlllpi
    yhqvavqfadfhdtpgrmlekgvisdilewktartflywrlrrllledqvkqeilqasge
    lshvhiqsmlrrwfvetegavkaylwdnnqvvvqwleqhwqagdgprstirenitylkhd
    svlktirglveenpevavdcviylsqhispaeraqvhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3tdcA (A:)
    tpyvtkdllqakrfqaqtlgttyiydfpemfrqalfklwgspdkypkdiltytelvldsq
    gqlvemnrlpggnevgmvafkmrfktqeypegrdvivignditfrigsfgpgedllylra
    semaraegipkiyvaansgarigmaeeikhmfhvawvdpedphkgfkylyltpqdytris
    slnsvhckhieeggesrymitdiigkddglgvenlrgsgmiagesslayeeivtislvtc
    raigigaylvrlgqrviqvenshiiltgasalnkvlgrevytsnnqlggvqimhyngvsh
    itvpddfegvytilewlsympkdnhspvpiitptdpidreieflpsrapydprwmlagrp
    hptlkgtwqsgffdhgsfkeimapwaqtvvtgrarlggipvgviavetrtvevavpadpa
    nldseakiiqqagqvwfpdsayktaqaikdfnreklplmifanwrgfsggmkdmydqvlk
    fgayivdglrqykqpiliyippyaelrggswvvidatinplciemyadkesrggvlepeg
    tveikfrkkdliksmrridpaykklmeqlgepdlsdkdrkdlegrlkaredlllpiyhqv
    avqfadfhdtpgrmlekgvisdilewktartflywrlrrllledqvkqeilqasgelshv
    hiqsmlrrwfvetegavkaylwdnnqvvvqwleqhwitylkhdsvlktirglveenpeva