PDB entry 3tc2

View 3tc2 on RCSB PDB site
Description: Crystal structure of potato serine protease inhibitor.
Class: Hydrolase Inhibitor
Keywords: beta-trefoil fold, Protease inhibitor, Hydrolase Inhibitor
Deposited on 2011-08-08, released 2012-06-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-04-16, with a file datestamp of 2014-04-11.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.171
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Kunitz-type proteinase inhibitor P1H5
    Species: Solanum tuberosum [TaxId:4113]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3tc2a_
  • Chain 'B':
    Compound: Kunitz-type proteinase inhibitor P1H5
    Species: Solanum tuberosum [TaxId:4113]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3tc2b_
  • Chain 'C':
    Compound: Kunitz-type proteinase inhibitor P1H5
    Species: Solanum tuberosum [TaxId:4113]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3tc2c_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3tc2A (A:)
    lpsdatpvldvtgkeldprlsyriistfwgalggdvylgkspnsdapcangvfrynsdvg
    psgtpvrfigssshfgqgifedellniqfaistskmcvsytiwkvgdydaslgtmlletg
    gtigqadsswfkivkssqfgynllycpvttssddqfclkvgvvhqngkrrlalvkdnpld
    vsfkqvq
    

    Sequence, based on observed residues (ATOM records): (download)
    >3tc2A (A:)
    psdatpvldvtgkeldprlsyriistfwgalggdvylgkspnsdapcangvfrynsdvgp
    sgtpvrfigssshfgqgifedellniqfaistskmcvsytiwkvgdydaslgtmlletgg
    tigqadsswfkivkssqfgynllycpvdqfclkvgvvhqngkrrlalvkdnpldvsfkqv
    q
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3tc2B (B:)
    lpsdatpvldvtgkeldprlsyriistfwgalggdvylgkspnsdapcangvfrynsdvg
    psgtpvrfigssshfgqgifedellniqfaistskmcvsytiwkvgdydaslgtmlletg
    gtigqadsswfkivkssqfgynllycpvttssddqfclkvgvvhqngkrrlalvkdnpld
    vsfkqvq
    

    Sequence, based on observed residues (ATOM records): (download)
    >3tc2B (B:)
    datpvldvtgkeldprlsyriistfwgalggdvylgkspnsdapcangvfrynsdvgpsg
    tpvrfigssshfgqgifedellniqfaistskmcvsytiwkvgdydaslgtmlletggti
    gqadsswfkivkssqfgynllycpvfclkvgvvhqngkrrlalvkdnpldvsfkqvq
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3tc2C (C:)
    lpsdatpvldvtgkeldprlsyriistfwgalggdvylgkspnsdapcangvfrynsdvg
    psgtpvrfigssshfgqgifedellniqfaistskmcvsytiwkvgdydaslgtmlletg
    gtigqadsswfkivkssqfgynllycpvttssddqfclkvgvvhqngkrrlalvkdnpld
    vsfkqvq
    

    Sequence, based on observed residues (ATOM records): (download)
    >3tc2C (C:)
    atpvldvtgkeldprlsyriistfwgalggdvylgkspnsdapcangvfrynsdvgpsgt
    pvrfigssshfgqgifedellniqfaistskmcvsytiwkvgdydaslgtmlletggtig
    qadsswfkivkssqfgynllycpvdqfclkvgvvhqngkrrlalvkdnpldvsfkqvq