PDB entry 3tau

View 3tau on RCSB PDB site
Description: Crystal Structure of a Putative Guanylate Monophosphaste Kinase from Listeria monocytogenes EGD-e
Class: transferase
Keywords: Structural Genomics, Center for Structural Genomics of Infectious Diseases, CSGID, Putative guanylate kinase, reversible phosphoryl transfer, TRANSFERASE
Deposited on 2011-08-04, released 2011-08-24
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-08-24, with a file datestamp of 2011-08-19.
Experiment type: XRAY
Resolution: 2.05 Å
R-factor: 0.184
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Guanylate kinase
    Species: Listeria monocytogenes [TaxId:1639]
    Gene: gmk, lmo1827
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3taua_
  • Chain 'B':
    Compound: Guanylate kinase
    Species: Listeria monocytogenes [TaxId:1639]
    Gene: gmk, lmo1827
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3taub_
  • Heterogens: SO4, NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3tauA (A:)
    snamtergllivlsgpsgvgkgtvreavfkdpetsfdysismttrlpregeqdgvdyyfr
    srevfeqaikdgkmleyaeyvgnyygtpleyveeklaagvdifleievqgamqvrkampe
    gififltppdlselknriigrgtesmevveermetakkeiemmasydyavvndvvanavq
    kikgivetehlktervihrykkmleglq
    

    Sequence, based on observed residues (ATOM records): (download)
    >3tauA (A:)
    tergllivlsgpsgvgkgtvreavfkdpetsfdysismttrlpregeqdgvdyyfrsrev
    feqaikdgkmleyaeyvgnyygtpleyveeklaagvdifleievqgamqvrkampegifi
    fltppdlselknrsmevveermetakkeiemmasydyavvndvvanavqkikgivetehl
    ktervihrykkml
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3tauB (B:)
    snamtergllivlsgpsgvgkgtvreavfkdpetsfdysismttrlpregeqdgvdyyfr
    srevfeqaikdgkmleyaeyvgnyygtpleyveeklaagvdifleievqgamqvrkampe
    gififltppdlselknriigrgtesmevveermetakkeiemmasydyavvndvvanavq
    kikgivetehlktervihrykkmleglq
    

    Sequence, based on observed residues (ATOM records): (download)
    >3tauB (B:)
    rgllivlsgpsgvgkgtvreavfkdpetsfdysismttrlpregeqdgvdyyfrsrevfe
    qaikdgkmleyaeyvgnyygtpleyveeklaagvdifleievqgamqvrkampegififl
    tppdlseeermetakkeiemmasydyavvndvvanavqkikgivetehlktervihrykk
    mle