PDB entry 3ta9

View 3ta9 on RCSB PDB site
Description: beta-Glucosidase A from the halothermophile H. orenii
Class: hydrolase
Keywords: TIM barrel, glucosidase, HYDROLASE
Deposited on 2011-08-03, released 2012-02-22
The last revision prior to the SCOPe 2.06 freeze date was dated 2012-02-22, with a file datestamp of 2012-02-17.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.195
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Glycoside hydrolase family 1
    Species: Halothermothrix orenii [TaxId:373903]
    Gene: Hore_15280
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3ta9a_
  • Chain 'B':
    Compound: Glycoside hydrolase family 1
    Species: Halothermothrix orenii [TaxId:373903]
    Gene: Hore_15280
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3ta9b_
  • Heterogens: NI, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3ta9A (A:)
    mhhhhhhmakiifpedfiwgaatssyqiegafnedgkgesiwdrfshtpgkiengdtgdi
    acdhyhlyredielmkeigirsyrfstswprilpegkgrvnqkgldfykrlvdnllkani
    rpmitlyhwdlpqalqdkggwtnrdtakyfaeyarlmfeefnglvdlwvthnepwvvafe
    ghafgnhapgtkdfktalqvahhlllshgmavdifreedlpgeigitlnltpaypagdse
    kdvkaasllddyinawflspvfkgsypeelhhiyeqnlgafttqpgdmdiisrdidflgi
    nyysrmvvrhkpgdnlfnaevvkmedrpstemgweiypqglydilvrvnkeytdkplyit
    engaafddklteegkihdekrinylgdhfkqaykalkdgvplrgyyvwslmdnfewaygy
    skrfgliyvdyengnrrflkdsalwyreviekgqvean
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ta9A (A:)
    akiifpedfiwgaatssyqiegafnedgkgesiwdrfshtpgkiengdtgdiacdhyhly
    redielmkeigirsyrfstswprilpegkgrvnqkgldfykrlvdnllkanirpmitlyh
    wdlpqalqdkggwtnrdtakyfaeyarlmfeefnglvdlwvthnepwvvafeghafgnha
    pgtkdfktalqvahhlllshgmavdifreedlpgeigitlnltpaypagdsekdvkaasl
    lddyinawflspvfkgsypeelhhiyeqnlgafttqpgdmdiisrdidflginyysrmvv
    rhkpgdnlfnaevvkmerpstemgweiypqglydilvrvnkeytdkplyitengaafddk
    lteegkihdekrinylgdhfkqaykalkdgvplrgyyvwslmdnfewaygyskrfgliyv
    dyengnrrflkdsalwyreviekgqvea
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3ta9B (B:)
    mhhhhhhmakiifpedfiwgaatssyqiegafnedgkgesiwdrfshtpgkiengdtgdi
    acdhyhlyredielmkeigirsyrfstswprilpegkgrvnqkgldfykrlvdnllkani
    rpmitlyhwdlpqalqdkggwtnrdtakyfaeyarlmfeefnglvdlwvthnepwvvafe
    ghafgnhapgtkdfktalqvahhlllshgmavdifreedlpgeigitlnltpaypagdse
    kdvkaasllddyinawflspvfkgsypeelhhiyeqnlgafttqpgdmdiisrdidflgi
    nyysrmvvrhkpgdnlfnaevvkmedrpstemgweiypqglydilvrvnkeytdkplyit
    engaafddklteegkihdekrinylgdhfkqaykalkdgvplrgyyvwslmdnfewaygy
    skrfgliyvdyengnrrflkdsalwyreviekgqvean
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ta9B (B:)
    iifpedfiwgaatssyqiegafnedgkgesiwdrfshtpgkiengdtgdiacdhyhlyre
    dielmkeigirsyrfstswprilpegkgrvnqkgldfykrlvdnllkanirpmitlyhwd
    lpqalqdkggwtnrdtakyfaeyarlmfeefnglvdlwvthnepwvvafeghafgnhapg
    tkdfktalqvahhlllshgmavdifreedlpgeigitlnltpaypagdsedvkaaslldd
    yinawflspvfkgsypeelhhiyeqnlgafttqpgdmdiisrdidflginyysrmvvrhk
    pnlfnaevvkmerpstemgweiypqglydilvrvnkeytdkplyitengaafddklteeg
    kihdekrinylgdhfkqaykalkdgvplrgyyvwslmdnfewaygyskrfgliyvdyeng
    nrrflkdsalwyreviekgqv