PDB entry 3t6k

View 3t6k on RCSB PDB site
Description: Crystal structure of a putative response regulator (Caur_3799) from Chloroflexus aurantiacus J-10-fl at 1.86 A resolution
Class: signaling protein
Keywords: Flavodoxin-like, Structural Genomics, Joint Center for Structural Genomics, JCSG, Protein Structure Initiative, PSI-BIOLOGY, SIGNALING PROTEIN
Deposited on 2011-07-28, released 2011-09-07
The last revision prior to the SCOPe 2.06 freeze date was dated 2014-12-24, with a file datestamp of 2014-12-19.
Experiment type: XRAY
Resolution: 1.86 Å
R-factor: 0.161
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Response regulator receiver
    Species: Chloroflexus aurantiacus [TaxId:324602]
    Gene: Caur_3799
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3t6ka_
  • Chain 'B':
    Compound: Response regulator receiver
    Species: Chloroflexus aurantiacus [TaxId:324602]
    Gene: Caur_3799
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3t6kb_
  • Heterogens: SO4, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3t6kA (A:)
    gmkphtllivddddtvaemlelvlrgagyevrraasgeealqqiyknlpdalicdvllpg
    idgytlckrvrqhpltktlpilmltaqgdisakiagfeagandylakpfepqelvyrvkn
    ilarttietpttpvqr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3t6kA (A:)
    kphtllivddddtvaemlelvlrgagyevrraasgeealqqiyknlpdalicdvllpgid
    gytlckrvrqhpltktlpilmltaqgdisakiagfeagandylakpfepqelvyrvknil
    ar
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3t6kB (B:)
    gmkphtllivddddtvaemlelvlrgagyevrraasgeealqqiyknlpdalicdvllpg
    idgytlckrvrqhpltktlpilmltaqgdisakiagfeagandylakpfepqelvyrvkn
    ilarttietpttpvqr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3t6kB (B:)
    kphtllivddddtvaemlelvlrgagyevrraasgeealqqiyknlpdalicdvllpgid
    gytlckrvrqhpltktlpilmltaqgdisakiagfeagandylakpfepqelvyrvknil
    ar