PDB entry 3t6e

View 3t6e on RCSB PDB site
Description: Crystal Structure of the Reaction Centre from Blastochloris viridis strain DSM 133 (ATCC 19567) substrain-94
Class: electron transport
Keywords: Pigment-protein complex, Electron transfer, Photosynthesis, Photosynthetic reaction center, Photosynthetic membranes, Evolution, Genetic drift, ELECTRON TRANSPORT
Deposited on 2011-07-28, released 2011-11-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-02-08, with a file datestamp of 2012-02-03.
Experiment type: XRAY
Resolution: 1.92 Å
R-factor: 0.156
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'C':
    Compound: Photosynthetic reaction center cytochrome c subunit
    Species: Blastochloris viridis [TaxId:1079]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3t6ec_
  • Chain 'H':
    Compound: reaction center protein h chain
    Species: Blastochloris viridis [TaxId:1079]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3t6eh1, d3t6eh2
  • Chain 'L':
    Compound: reaction center protein l chain
    Species: Blastochloris viridis [TaxId:1079]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3t6el_
  • Chain 'M':
    Compound: reaction center protein m chain
    Species: Blastochloris viridis [TaxId:1079]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3t6em_
  • Heterogens: HEC, LDA, DGA, SO4, HTO, GOL, BCB, BPB, UQ9, MQ9, FE2, NS5, HOH

PDB Chain Sequences:

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3t6eC (C:)
    mkqlivnsvatvalaslvagcfepppatttqtgfrglsmgevlhpatvkakkerdaqypp
    alaavkaegppvsqvyknvkvlgnlteaeflrtmtaitewvspqegctychdennlasea
    kypyvvarrmlemtraintnwtqhvaqtgvtcytchrgtplppyvryleptlplnnretp
    thvervetrsgyvvrlakytaysalnydpftmflandkrqvrvvpqtalplvgvsrgker
    rplsdayatfalmmsisdslgtnctfchnaqtfeswgkkstpqraiawwgirmvrdlnmn
    ylaplnaslpasrlgrqgeapqadcrtchqgvtkplfgasrlkdypelgpikaaak
    

    Sequence, based on observed residues (ATOM records): (download)
    >3t6eC (C:)
    cfepppatttqtgfrglsmgevlhpatvkakkerdaqyppalaavkaegppvsqvyknvk
    vlgnlteaeflrtmtaitewvspqegctychdennlaseakypyvvarrmlemtraintn
    wtqhvaqtgvtcytchrgtplppyvryleptlplnnretpthvervetrsgyvvrlakyt
    aysalnydpftmflandkrqvrvvpqtalplvgvsrgkerrplsdayatfalmmsisdsl
    gtnctfchnaqtfeswgkkstpqraiawwgirmvrdlnmnylaplnaslpasrlgrqgea
    pqadcrtchqgvtkplfgasrlkdypelgpikaa
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3t6eH (H:)
    myhgalaqhldiaqlvwyaqwlviwtvvllylrredrregyplveplglvklapedgqvy
    elpypktfvlphggtvtvprrrpetrelklaqtdgfegaplqptgnplvdavgpasyaer
    aevvdatvdgkakivplrvatdfsiaegdvdprglpvvaadgveagtvtdlwvdrsehyf
    rylelsvagsartaliplgfcdvkkdkivvtsilseqfanvprlqsrdqitlreedkvsa
    yyaggllyatperaesll
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3t6eL (L:)
    allsferkyrvrggtliggdlfdfwvgpyfvgffgvsaiffiflgvsligyaasqgptwd
    pfaisinppdlkyglgaaplleggfwqaitvcalgafiswmlreveisrklgigwhvpla
    fcvpifmfcvlqvfrplllgswghafpygilshldwvnnfgyqylnwhynpghmssvsfl
    fvnamalglhgglilsvanpgdgdkvktaehenqyfrdvvgysigalsihrlglflasni
    fltgafgtiasgpfwtrgwpewwgwwldipfws
    

  • Chain 'M':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3t6eM (M:)
    adyqtiytqiqargphitvsgewgdndrvgkpfysywlgkigdaqigpiylgasgiaafa
    fgstailiilfnmaaevhfdplqffrqffwlglyppkaqygmgipplhdggwwlmaglfm
    tlslgswwirvysraralglgthiawnfaaaiffvlcigcihptlvgswsegvpfgiwph
    idwltafsirygnfyycpwhgfsigfaygcgllfaahgatilavarfggdreieqitdrg
    taveraalfwrwtigfnatiesvhrwgwffslmvmvsasvgilltgtfvdnwylwcvkhg
    aapdypaylpatpdpaslpgapk