PDB entry 3t6d

View 3t6d on RCSB PDB site
Description: Crystal Structure of the Reaction Centre from Blastochloris viridis strain DSM 133 (ATCC 19567) substrain-08
Class: electron transport
Keywords: Pigment-protein complex, Electron transport, Photosynthesis, Photosynthetic reaction center, Photosynthetic membranes, Evolution, Genetic drift
Deposited on 2011-07-28, released 2011-11-23
The last revision prior to the SCOPe 2.02 freeze date was dated 2012-02-08, with a file datestamp of 2012-02-03.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: 0.183
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'C':
    Compound: Photosynthetic reaction center cytochrome c subunit
    Species: Blastochloris viridis [TaxId:1079]
    Database cross-references and differences (RAF-indexed):
  • Chain 'H':
    Compound: Photosynthetic reaction center H-subunit
    Species: Blastochloris viridis [TaxId:1079]
    Database cross-references and differences (RAF-indexed):
  • Chain 'L':
    Compound: Photosynthetic reaction center L-subunit
    Species: Blastochloris viridis [TaxId:1079]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d3t6dl_
  • Chain 'M':
    Compound: Photosynthetic reaction center M-subunit
    Species: Blastochloris viridis [TaxId:1079]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d3t6dm_
  • Heterogens: HEC, LDA, DGA, SO4, HTO, GOL, BCB, BPB, UQ9, FE2, MQ9, NS5, HTH, HOH

PDB Chain Sequences:

  • Chain 'C':
    No sequence available.

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3t6dL (L:)
    allsferkyrvrggtliggdlfdfwvgpyfvgffgvsaiffiflgvsligyaasqgptwd
    pfaisinppdlkyglgaaplleggfwqaitvcalgafiswmlreveisrklgigwhvpla
    fcvpifmfcvlqvfrplllgswghafpygilshldwvnnfgyqylnwhynpghmssvsfl
    fvnamalglhgglilsvanpgdgdkvktaehenqyfrdvvgysigalsihrlglflasni
    fltgafgtiasgpfwtrgwpewwgwwldipfws
    

  • Chain 'M':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3t6dM (M:)
    adyqtiytqiqargphitvsgewgdndrigkpfysywlgkigdaqigpiylgasgiaafa
    fgatailiigfnmlaevhfdplqffrqffwlglyppkaqygmgipplhdggwwlmaglfm
    tlslgswwirvysraralglgthiawnfaaaiffvlcigcihpalvgswsegvpfgiwph
    idwltafsirygnfyycpwhgfsigfaygcgllfaahgatilavarfggdreieqitdrg
    taveraalfwrwtigfnatiesvhrwgwffslmvmvsasvgilltgtfvdnwylwcvkhg
    aapdypaylpatpdpaslpgapk