PDB entry 3t6c

View 3t6c on RCSB PDB site
Description: Crystal structure of an enolase from pantoea ananatis (efi target efi-501676) with bound d-gluconate and mg
Class: lyase
Keywords: Enolase, mannonate dehydratase related protein, enzyme function intitiative, Lyase, Hydro-lyases, Structural Genomics
Deposited on 2011-07-28, released 2011-08-31
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: N/A
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Putative ManD family dehydratase
    Species: Pantoea ananatis [TaxId:706191]
    Gene: rspA, PANA_0592
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3t6ca1, d3t6ca2
  • Chain 'B':
    Compound: Putative ManD family dehydratase
    Species: Pantoea ananatis [TaxId:706191]
    Gene: rspA, PANA_0592
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3t6cb1, d3t6cb2
  • Heterogens: MG, GCO, CL, EDO, UNX, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3t6cA (A:)
    mhhhhhhssgvdlgtenlyfqsmmsnlfitnvktiltapggidlvvvkietnepglyglg
    catftqriyavqsaideylapfligkdpariediwqsaavsgywrngpvmnnalsgidma
    lwdikgkqaglpvyellggkcrdgialyvhtdgadevevedsarakmeegyqyircqmgm
    yggagtddlrlianrmvkakniqpkrsprtkapgiyfdpeayaksiprlfdhlrnklgfs
    vellhdaheritpinaihmakalepyqlffledpvapentewlkmlrqqsstpiamgelf
    vnvnewkplidnklidyirchissiggitpakkiaiyselngvrtawhspgdispigvca
    nmhldlsspnfgiqeytpmndalrevfpgcpevdqgyayvndkpglgidinealaakfpc
    eggnptwtmartpdgtvwrp
    

    Sequence, based on observed residues (ATOM records): (download)
    >3t6cA (A:)
    nlfitnvktiltapggidlvvvkietnepglyglgcatftqriyavqsaideylapflig
    kdpariediwqsaavsgywrngpvmnnalsgidmalwdikgkqaglpvyellggkcrdgi
    alyvhtdgadevevedsarakmeegyqyircqmgmyggagtddlrlianrmvkakniqpk
    rsprtkapgiyfdpeayaksiprlfdhlrnklgfsvellhdaheritpinaihmakalep
    yqlffledpvapentewlkmlrqqsstpiamgelfvnvnewkplidnklidyirchissi
    ggitpakkiaiyselngvrtawhspgdispigvcanmhldlsspnfgiqeytpmndalre
    vfpgcpevdqgyayvndkpglgidinealaakfpceggnptwtmartpdgtvwrp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3t6cB (B:)
    mhhhhhhssgvdlgtenlyfqsmmsnlfitnvktiltapggidlvvvkietnepglyglg
    catftqriyavqsaideylapfligkdpariediwqsaavsgywrngpvmnnalsgidma
    lwdikgkqaglpvyellggkcrdgialyvhtdgadevevedsarakmeegyqyircqmgm
    yggagtddlrlianrmvkakniqpkrsprtkapgiyfdpeayaksiprlfdhlrnklgfs
    vellhdaheritpinaihmakalepyqlffledpvapentewlkmlrqqsstpiamgelf
    vnvnewkplidnklidyirchissiggitpakkiaiyselngvrtawhspgdispigvca
    nmhldlsspnfgiqeytpmndalrevfpgcpevdqgyayvndkpglgidinealaakfpc
    eggnptwtmartpdgtvwrp
    

    Sequence, based on observed residues (ATOM records): (download)
    >3t6cB (B:)
    lfitnvktiltapggidlvvvkietnepglyglgcatftqriyavqsaideylapfligk
    dpariediwqsaavsgywrngpvmnnalsgidmalwdikgkqaglpvyellggkcrdgia
    lyvhtdgadevevedsarakmeegyqyircqmgmyggagtddlrlianrmvkakniqpkr
    sprtkapgiyfdpeayaksiprlfdhlrnklgfsvellhdaheritpinaihmakalepy
    qlffledpvapentewlkmlrqqsstpiamgelfvnvnewkplidnklidyirchissig
    gitpakkiaiyselngvrtawhspgdispigvcanmhldlsspnfgiqeytpmndalrev
    fpgcpevdqgyayvndkpglgidinealaakfpceggnptwtmartpdgtvwrp