PDB entry 3t3c

View 3t3c on RCSB PDB site
Description: Structure of HIV PR resistant patient derived mutant (comprising 22 mutations) in complex with DRV
Class: hydrolase
Keywords: peptidase, viral particle, HYDROLASE
Deposited on 2011-07-25, released 2012-06-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-08-22, with a file datestamp of 2012-08-17.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.184
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hiv-1 protease
    Species: Human immunodeficiency virus type 1 [TaxId:11686]
    Gene: gag-pol
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03367 (0-98)
      • engineered mutation (3)
      • engineered mutation (9)
      • engineered mutation (12-13)
      • engineered mutation (19)
      • engineered mutation (21)
      • engineered mutation (32)
      • engineered mutation (34-36)
      • engineered mutation (40)
      • engineered mutation (42)
      • engineered mutation (47)
      • engineered mutation (53)
      • engineered mutation (65)
      • engineered mutation (68)
      • engineered mutation (73)
      • engineered mutation (81)
      • engineered mutation (83)
      • engineered mutation (88-90)
    Domains in SCOPe 2.07: d3t3ca_
  • Chain 'B':
    Compound: hiv-1 protease
    Species: Human immunodeficiency virus type 1 [TaxId:11686]
    Gene: gag-pol
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03367 (0-98)
      • engineered mutation (3)
      • engineered mutation (9)
      • engineered mutation (12-13)
      • engineered mutation (19)
      • engineered mutation (21)
      • engineered mutation (32)
      • engineered mutation (34-36)
      • engineered mutation (40)
      • engineered mutation (42)
      • engineered mutation (47)
      • engineered mutation (53)
      • engineered mutation (65)
      • engineered mutation (68)
      • engineered mutation (73)
      • engineered mutation (81)
      • engineered mutation (83)
      • engineered mutation (88-90)
    Domains in SCOPe 2.07: d3t3cb_
  • Heterogens: 017, BME, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3t3cA (A:)
    pqislwqrpvvtariggqlievlldtgaddtviedidlpgkwspkmiagiggfvkvrqyd
    qiliefcgkkaigsvlvgptpanvigrnimsqigctlnf
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3t3cB (B:)
    pqislwqrpvvtariggqlievlldtgaddtviedidlpgkwspkmiagiggfvkvrqyd
    qiliefcgkkaigsvlvgptpanvigrnimsqigctlnf