PDB entry 3t3a

View 3t3a on RCSB PDB site
Description: Crystal structure of H107R mutant of extracellular domain of mouse receptor NKR-P1A
Class: signaling protein
Keywords: C-type lectin-like domain, domain swapping, twinning, natural killer cell receptor, transmembrane receptor, SIGNALING PROTEIN
Deposited on 2011-07-25, released 2011-08-10
The last revision prior to the SCOPe 2.03 freeze date was dated 2012-03-28, with a file datestamp of 2012-03-23.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.191
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Killer cell lectin-like receptor subfamily B member 1A
    Species: MUS MUSCULUS [TaxId:10090]
    Gene: Klrb1a, Ly55, Ly55a, Nkrp1a
    Database cross-references and differences (RAF-indexed):
    • Uniprot P27811
      • engineered mutation (18)
      • variant (21)
      • variant (93)
    Domains in SCOPe 2.03: d3t3aa_
  • Chain 'B':
    Compound: Killer cell lectin-like receptor subfamily B member 1A
    Species: MUS MUSCULUS [TaxId:10090]
    Gene: Klrb1a, Ly55, Ly55a, Nkrp1a
    Database cross-references and differences (RAF-indexed):
    • Uniprot P27811
      • engineered mutation (18)
      • variant (21)
      • variant (93)
    Domains in SCOPe 2.03: d3t3ab_
  • Heterogens: PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3t3aA (A:)
    saklecpqdwlshrdkcfrvsqvsntweeglvdcdgkgatlmliqdqeelrflldsikek
    ynsfwiglrytlpdmnwkwingstlnsdvlkitgdtendscaaisgdkvtfescnsdnrw
    icqkelyhetlsnyvgygh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3t3aA (A:)
    ecpqdwlshrdkcfrvsqvsntweeglvdcdgkgatlmliqdqeelrflldsikekynsf
    wiglrytlpdmnwkwingstlnsdvlkitgdtendscaaisgdkvtfescnsdnrwicqk
    el
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3t3aB (B:)
    saklecpqdwlshrdkcfrvsqvsntweeglvdcdgkgatlmliqdqeelrflldsikek
    ynsfwiglrytlpdmnwkwingstlnsdvlkitgdtendscaaisgdkvtfescnsdnrw
    icqkelyhetlsnyvgygh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3t3aB (B:)
    ecpqdwlshrdkcfrvsqvsntweeglvdcdgkgatlmliqdqeelrflldsikeknsfw
    iglrytlmnwkwingstlnsdvlkitgdtendscaaisgdkvtfescnsdnrwicqkel