PDB entry 3t2x

View 3t2x on RCSB PDB site
Description: Structure of shwanavidin low affinity mutant (F43A)
Class: Biotin-binding protein
Keywords: avidin, biotin, streptavidin, shwanavidin, high affinity systems, Biotin-binding protein
Deposited on 2011-07-23, released 2012-04-11
The last revision prior to the SCOPe 2.02 freeze date was dated 2012-06-13, with a file datestamp of 2012-06-08.
Experiment type: XRAY
Resolution: 1.15 Å
R-factor: 0.146
AEROSPACI score: 0.87 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Avidin/streptavidin
    Species: Shewanella denitrificans [TaxId:318161]
    Gene: Sden_0912
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q12QS6 (2-End)
      • engineered mutation (42)
    Domains in SCOPe 2.02: d3t2xa_
  • Chain 'B':
    Compound: Avidin/streptavidin
    Species: Shewanella denitrificans [TaxId:318161]
    Gene: Sden_0912
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q12QS6 (2-End)
      • engineered mutation (42)
    Domains in SCOPe 2.02: d3t2xb_
  • Chain 'C':
    Compound: Avidin/streptavidin
    Species: Shewanella denitrificans [TaxId:318161]
    Gene: Sden_0912
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q12QS6
      • engineered mutation (42)
    Domains in SCOPe 2.02: d3t2xc_
  • Chain 'D':
    Compound: Avidin/streptavidin
    Species: Shewanella denitrificans [TaxId:318161]
    Gene: Sden_0912
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q12QS6 (2-End)
      • engineered mutation (42)
    Domains in SCOPe 2.02: d3t2xd_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3t2xA (A:)
    mamaqeltamsawvnqdgstlyinsinaqgeltgsyinraagaacqnspypvngwvfgta
    isfstkwlnsvescnsitswsgfyintggqgkistlwqlvvngssspsqilkgqdvfsqt
    sa
    

    Sequence, based on observed residues (ATOM records): (download)
    >3t2xA (A:)
    maqeltamsawvnqdgstlyinsinaqgeltgsyinraagaacqnspypvngwvfgtais
    fstkwlnsvescnsitswsgfyintggqgkistlwqlvvngssspsqilkgqdvfsqts
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3t2xB (B:)
    mamaqeltamsawvnqdgstlyinsinaqgeltgsyinraagaacqnspypvngwvfgta
    isfstkwlnsvescnsitswsgfyintggqgkistlwqlvvngssspsqilkgqdvfsqt
    sa
    

    Sequence, based on observed residues (ATOM records): (download)
    >3t2xB (B:)
    maqeltamsawvnqdgstlyinsinaqgeltgsyinraagaacqnspypvngwvfgtais
    fstkwlnsvescnsitswsgfyintggqgkistlwqlvvngssspsqilkgqdvfsqts
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3t2xC (C:)
    mamaqeltamsawvnqdgstlyinsinaqgeltgsyinraagaacqnspypvngwvfgta
    isfstkwlnsvescnsitswsgfyintggqgkistlwqlvvngssspsqilkgqdvfsqt
    sa
    

    Sequence, based on observed residues (ATOM records): (download)
    >3t2xC (C:)
    aqeltamsawvnqdgstlyinsinaqgeltgsyinraagaacqnspypvngwvfgtaisf
    stkwlnsvescnsitswsgfyintggqgkistlwqlvvngssspsqilkgqdvfsqt
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3t2xD (D:)
    mamaqeltamsawvnqdgstlyinsinaqgeltgsyinraagaacqnspypvngwvfgta
    isfstkwlnsvescnsitswsgfyintggqgkistlwqlvvngssspsqilkgqdvfsqt
    sa
    

    Sequence, based on observed residues (ATOM records): (download)
    >3t2xD (D:)
    maqeltamsawvnqdgstlyinsinaqgeltgsyinraagaacqnspypvngwvfgtais
    fstkwlnsvescnsitswsgfyintggqgkistlwqlvvngssspsqilkgqdvfsqts