PDB entry 3t2n

View 3t2n on RCSB PDB site
Description: Human hepsin protease in complex with the Fab fragment of an inhibitory antibody
Class: hydrolase
Keywords: Type II transmembrane serine protease, SRCR domain, Substrates include pro-hepsin, pro-HGF, Laminin-332, Transmembrane, HYDROLASE
Deposited on 2011-07-22, released 2011-12-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-07-25, with a file datestamp of 2012-07-20.
Experiment type: XRAY
Resolution: 2.55 Å
R-factor: 0.244
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Serine protease hepsin
    Species: Homo sapiens [TaxId:9606]
    Gene: HPN, TMPRSS1
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Serine protease hepsin
    Species: Homo sapiens [TaxId:9606]
    Gene: HPN, TMPRSS1
    Database cross-references and differences (RAF-indexed):
  • Chain 'H':
    Compound: Antibody, Fab fragment, Heavy Chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3T2N (0-End)
  • Chain 'I':
    Compound: Antibody, Fab fragment, Heavy Chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3T2N (0-End)
  • Chain 'L':
    Compound: Antibody, Fab fragment, Light Chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3T2N (0-End)
    Domains in SCOPe 2.07: d3t2nl1, d3t2nl2
  • Chain 'M':
    Compound: Antibody, Fab fragment, Light Chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3T2N (0-End)
    Domains in SCOPe 2.07: d3t2nm1, d3t2nm2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'H':
    No sequence available.

  • Chain 'I':
    No sequence available.

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >3t2nL (L:)
    qtvvtqepsltvspggtvtltcrsstgavttsnyanwvqqkpgqafrgligdtnnrapwt
    parfsgsllggkaaltlsgvqpedeaeyycalwysnhfifgsgtkvtvlgqpkaapsvtl
    fppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskqsnnkyaassy
    lsltpeqwkshrsyscqvthegstvektvaptecs
    

    Sequence, based on observed residues (ATOM records): (download)
    >3t2nL (L:)
    qtvvtqepsltvspggtvtltcrsstgavttsnyanwvqqkpgqafrgligdtnnrapwt
    parfsgsllggkaaltlsgvqpedeaeyycalwysnhfifgsgtkvtvlgqpkaapsvtl
    fppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskqsnnkyaassy
    lsltpeqwkshrsyscqvthegstvektvap
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >3t2nM (M:)
    qtvvtqepsltvspggtvtltcrsstgavttsnyanwvqqkpgqafrgligdtnnrapwt
    parfsgsllggkaaltlsgvqpedeaeyycalwysnhfifgsgtkvtvlgqpkaapsvtl
    fppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskqsnnkyaassy
    lsltpeqwkshrsyscqvthegstvektvaptecs
    

    Sequence, based on observed residues (ATOM records): (download)
    >3t2nM (M:)
    qtvvtqepsltvspggtvtltcrsstgavttsnyanwvqqkpgqafrgligdtnnrapwt
    parfsgsllggkaaltlsgvqpedeaeyycalwysnhfifgsgtkvtvlgqpkaapsvtl
    fppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskqsnnkyaassy
    lsltpeqwkshrsyscqvthegstvektvapt