PDB entry 3t0w

View 3t0w on RCSB PDB site
Description: Fluorogen activating protein M8VL in complex with dimethylindole red
Class: dye-binding protein
Keywords: immunoglobulin fold, fluorogen activation, dimethylindole red, DYE-BINDING PROTEIN
Deposited on 2011-07-20, released 2012-03-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-04-11, with a file datestamp of 2012-04-06.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.15
AEROSPACI score: 0.66 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: immunoglobulin variable lambda domain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3T0W (0-End)
    Domains in SCOPe 2.07: d3t0wa_
  • Chain 'B':
    Compound: immunoglobulin variable lambda domain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3T0W (0-End)
    Domains in SCOPe 2.07: d3t0wb_
  • Heterogens: CL, PE3, DIW, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3t0wA (A:)
    epvltqspsvsgtpgqkvtifcsgsssnvednsvywyqqfpgttpkvliynddrrssgvp
    drfsgsksgtsaslaisglrsedeadyyclswddslngwvfgggtkvtvldaasgadhhh
    hhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3t0wA (A:)
    epvltqspsvsgtpgqkvtifcsgsssnvednsvywyqqfpgttpkvliynddrrssgvp
    drfsgsksgtsaslaisglrsedeadyyclswddslngwvfgggtkvtvld
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3t0wB (B:)
    epvltqspsvsgtpgqkvtifcsgsssnvednsvywyqqfpgttpkvliynddrrssgvp
    drfsgsksgtsaslaisglrsedeadyyclswddslngwvfgggtkvtvldaasgadhhh
    hhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3t0wB (B:)
    epvltqspsvsgtpgqkvtifcsgsssnvednsvywyqqfpgttpkvliynddrrssgvp
    drfsgsksgtsaslaisglrsedeadyyclswddslngwvfgggtkvtvld