PDB entry 3t0l

View 3t0l on RCSB PDB site
Description: Small-molecule inhibitors of 14-3-3 protein-protein interactions from virtual screening
Class: protein binding/inhibitor
Keywords: Helical protein, Adapter protein, Protein-protein interaction, PROTEIN BINDING-INHIBITOR complex
Deposited on 2011-07-20, released 2012-12-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-09-04, with a file datestamp of 2013-08-30.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.158
AEROSPACI score: 0.64 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 14-3-3 protein sigma
    Species: Homo sapiens [TaxId:9606]
    Gene: HME1, SFN
    Database cross-references and differences (RAF-indexed):
    • Uniprot P31947 (4-234)
      • expression tag (0-3)
    Domains in SCOPe 2.07: d3t0la1, d3t0la2
  • Heterogens: 1CT, GOL, CL, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3t0lA (A:)
    amgsmerasliqkaklaeqaeryedmaafmkgavekgeelsceernllsvayknvvggqr
    aawrvlssieqksneegseekgpevreyrekvetelqgvcdtvlglldshlikeagdaes
    rvfylkmkgdyyrylaevatgddkkriidsarsayqeamdiskkempptnpirlglalnf
    svfhyeianspeeaislakttfdeamadlhtlsedsykdstlimqllrdnltlwt
    

    Sequence, based on observed residues (ATOM records): (download)
    >3t0lA (A:)
    amgsmerasliqkaklaeqaeryedmaafmkgavekgeelsceernllsvayknvvggqr
    aawrvlssieqksnkgpevreyrekvetelqgvcdtvlglldshlikeagdaesrvfylk
    mkgdyyrylaevatgddkkriidsarsayqeamdiskkempptnpirlglalnfsvfhye
    ianspeeaislakttfdeamadlhtlsedsykdstlimqllrdnltlwt