PDB entry 3szi

View 3szi on RCSB PDB site
Description: Structure of apo shwanavidin (P21 form)
Class: Biotin-binding protein
Keywords: High affinity systems, avidin, streptavidin, biotin, rhizavidin, shwanavidin, Biotin-binding protein
Deposited on 2011-07-19, released 2012-04-25
The last revision prior to the SCOPe 2.02 freeze date was dated 2012-06-13, with a file datestamp of 2012-06-08.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: 0.159
AEROSPACI score: 0.7 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Avidin/streptavidin
    Species: Shewanella denitrificans [TaxId:318161]
    Gene: Sden_0912
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d3szia_
  • Chain 'B':
    Compound: Avidin/streptavidin
    Species: Shewanella denitrificans [TaxId:318161]
    Gene: Sden_0912
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d3szib_
  • Chain 'C':
    Compound: Avidin/streptavidin
    Species: Shewanella denitrificans [TaxId:318161]
    Gene: Sden_0912
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d3szic_
  • Chain 'D':
    Compound: Avidin/streptavidin
    Species: Shewanella denitrificans [TaxId:318161]
    Gene: Sden_0912
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q12QS6 (2-End)
      • expression tag (1)
  • Chain 'E':
    Compound: Avidin/streptavidin
    Species: Shewanella denitrificans [TaxId:318161]
    Gene: Sden_0912
    Database cross-references and differences (RAF-indexed):
  • Chain 'F':
    Compound: Avidin/streptavidin
    Species: Shewanella denitrificans [TaxId:318161]
    Gene: Sden_0912
    Database cross-references and differences (RAF-indexed):
  • Chain 'G':
    Compound: Avidin/streptavidin
    Species: Shewanella denitrificans [TaxId:318161]
    Gene: Sden_0912
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q12QS6 (2-End)
      • expression tag (1)
    Domains in SCOPe 2.02: d3szig_
  • Chain 'H':
    Compound: Avidin/streptavidin
    Species: Shewanella denitrificans [TaxId:318161]
    Gene: Sden_0912
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d3szih_
  • Chain 'I':
    Compound: Avidin/streptavidin
    Species: Shewanella denitrificans [TaxId:318161]
    Gene: Sden_0912
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d3szii_
  • Chain 'J':
    Compound: Avidin/streptavidin
    Species: Shewanella denitrificans [TaxId:318161]
    Gene: Sden_0912
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q12QS6 (2-End)
      • expression tag (1)
    Domains in SCOPe 2.02: d3szij_
  • Chain 'K':
    Compound: Avidin/streptavidin
    Species: Shewanella denitrificans [TaxId:318161]
    Gene: Sden_0912
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d3szik_
  • Chain 'L':
    Compound: Avidin/streptavidin
    Species: Shewanella denitrificans [TaxId:318161]
    Gene: Sden_0912
    Database cross-references and differences (RAF-indexed):
  • Heterogens: FMT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3sziA (A:)
    mamaqeltamsawvnqdgstlyinsinaqgeltgsyinraagfacqnspypvngwvfgta
    isfstkwlnsvescnsitswsgfyintggqgkistlwqlvvngssspsqilkgqdvfsqt
    sa
    

    Sequence, based on observed residues (ATOM records): (download)
    >3sziA (A:)
    eltamsawvnqdgstlyinsinaqgeltgsyinraagfacqnspypvngwvfgtaisfst
    kwlnsvescnsitswsgfyintggqgkistlwqlvvngssspsqilkgqdvfsqtsa
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3sziB (B:)
    mamaqeltamsawvnqdgstlyinsinaqgeltgsyinraagfacqnspypvngwvfgta
    isfstkwlnsvescnsitswsgfyintggqgkistlwqlvvngssspsqilkgqdvfsqt
    sa
    

    Sequence, based on observed residues (ATOM records): (download)
    >3sziB (B:)
    ltamsawvnqdgstlyinsinaqgeltgsyinraafacqnspypvngwvfgtaisfstkw
    lnsvescnsitswsgfyintggqgkistlwqlvvngssspsqilkgqdvfsqt
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3sziC (C:)
    mamaqeltamsawvnqdgstlyinsinaqgeltgsyinraagfacqnspypvngwvfgta
    isfstkwlnsvescnsitswsgfyintggqgkistlwqlvvngssspsqilkgqdvfsqt
    sa
    

    Sequence, based on observed residues (ATOM records): (download)
    >3sziC (C:)
    aqeltamsawvnqdgstlyinsinaqgeltgsyinraagfacqnspypvngwvfgtaisf
    stkwlnsvescnsitswsgfyintggqgkistlwqlvvngssspsqilkgqdvfsqt
    

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    No sequence available.

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >3sziG (G:)
    mamaqeltamsawvnqdgstlyinsinaqgeltgsyinraagfacqnspypvngwvfgta
    isfstkwlnsvescnsitswsgfyintggqgkistlwqlvvngssspsqilkgqdvfsqt
    sa
    

    Sequence, based on observed residues (ATOM records): (download)
    >3sziG (G:)
    amaqeltamsawvnqdgstlyinsinaqgeltgsyinraagfacqnspypvngwvfgtai
    sfstkwlnsvescnsitswsgfyintggqgkistlwqlvvngssspsqilkgqdvfsqt
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >3sziH (H:)
    mamaqeltamsawvnqdgstlyinsinaqgeltgsyinraagfacqnspypvngwvfgta
    isfstkwlnsvescnsitswsgfyintggqgkistlwqlvvngssspsqilkgqdvfsqt
    sa
    

    Sequence, based on observed residues (ATOM records): (download)
    >3sziH (H:)
    aqeltamsawvnqdgstlyinsinaqgeltgsyinraagfacqnspypvngwvfgtaisf
    stkwlnsvescnsitswsgfyintggqgkistlwqlvvngssspsqilkgqdvfsqt
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >3sziI (I:)
    mamaqeltamsawvnqdgstlyinsinaqgeltgsyinraagfacqnspypvngwvfgta
    isfstkwlnsvescnsitswsgfyintggqgkistlwqlvvngssspsqilkgqdvfsqt
    sa
    

    Sequence, based on observed residues (ATOM records): (download)
    >3sziI (I:)
    aqeltamsawvnqdgstlyinsinaqgeltgsyinraagfacqnspypvngwvfgtaisf
    stkwlnsvescnsitswsgfyintggqgkistlwqlvvngssspsqilkgqdvfsqt
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >3sziJ (J:)
    mamaqeltamsawvnqdgstlyinsinaqgeltgsyinraagfacqnspypvngwvfgta
    isfstkwlnsvescnsitswsgfyintggqgkistlwqlvvngssspsqilkgqdvfsqt
    sa
    

    Sequence, based on observed residues (ATOM records): (download)
    >3sziJ (J:)
    amaqeltamsawvnqdgstlyinsinaqgeltgsyinraagfacqnspypvngwvfgtai
    sfstkwlnsvescnsitswsgfyintggqgkistlwqlvvngssspsqilkgqdvfsqt
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >3sziK (K:)
    mamaqeltamsawvnqdgstlyinsinaqgeltgsyinraagfacqnspypvngwvfgta
    isfstkwlnsvescnsitswsgfyintggqgkistlwqlvvngssspsqilkgqdvfsqt
    sa
    

    Sequence, based on observed residues (ATOM records): (download)
    >3sziK (K:)
    maqeltamsawvnqdgstlyinsinaqgeltgsyinraafacqnspypvngwvfgtaisf
    stkwlnsvescnsitswsgfyintggqgkistlwqlvvngssspsqilkgqdvfsqt
    

  • Chain 'L':
    No sequence available.